KEGG   Alicycliphilus denitrificans BC: Alide_3652Help
Entry
Alide_3652        CDS       T01397                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
adn  Alicycliphilus denitrificans BC
Pathway
adn00071  Fatty acid degradation
adn00280  Valine, leucine and isoleucine degradation
adn00281  Geraniol degradation
adn00310  Lysine degradation
adn00360  Phenylalanine metabolism
adn00362  Benzoate degradation
adn00380  Tryptophan metabolism
adn00410  beta-Alanine metabolism
adn00627  Aminobenzoate degradation
adn00640  Propanoate metabolism
adn00650  Butanoate metabolism
adn00903  Limonene and pinene degradation
adn00930  Caprolactam degradation
adn01100  Metabolic pathways
adn01110  Biosynthesis of secondary metabolites
adn01120  Microbial metabolism in diverse environments
adn01130  Biosynthesis of antibiotics
adn01212  Fatty acid metabolism
Module
adn_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:adn00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Alide_3652
   00650 Butanoate metabolism
    Alide_3652
  Lipid metabolism
   00071 Fatty acid degradation
    Alide_3652
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Alide_3652
   00310 Lysine degradation
    Alide_3652
   00360 Phenylalanine metabolism
    Alide_3652
   00380 Tryptophan metabolism
    Alide_3652
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Alide_3652
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Alide_3652
   00281 Geraniol degradation
    Alide_3652
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Alide_3652
   00627 Aminobenzoate degradation
    Alide_3652
   00930 Caprolactam degradation
    Alide_3652
Enzymes [BR:adn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Alide_3652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49 SDH_sah
Motif
Other DBs
NCBI-ProteinID: ADV01368
JGI: Alide_3652
UniProt: E8TR17
Position
3800437..3801216
Genome map
AA seq 259 aa AA seqDB search
MAYECIEVRTEADKVGIITLNRPKQLNALNDQLMDELGAALKAFDADEKIGCIVLTGSEK
AFAAGADIGAMAKYSFADAYKGDYITRNWEAIRSIRKPVIAAVAGYALGGGCELAMMCDF
IIAADNARFGQPEIKLGVIPGAGGTQRLPRAVGKAKAMDMTLTARMMDAAEAERAGLVSR
VVPQDKLMEEALGAAIVISGFSQIAVMAAKESVNRAFEGTLSDGVMFERRLFHSLFATQD
QKEGMDAFVNKRAPNFTHQ
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
ttggcctacgaatgcatcgaagtccgcaccgaggcggacaaggtcggcatcatcacgctg
aaccgtcccaagcagctcaacgcgctgaacgaccagctcatggacgagctgggcgcggcc
ctcaaggcgttcgacgccgacgagaagatcggctgcatcgtcctcacgggcagcgagaag
gccttcgccgccggcgcagacatcggcgccatggccaagtacagcttcgccgacgcctac
aagggcgactacatcacgcgcaactgggaagccatccgctcgatccgcaagcccgtgatc
gcggccgtggccggctacgccctgggcggcggctgcgagctggcgatgatgtgcgacttc
atcatcgccgccgacaacgcccgcttcggccagcccgagatcaagctcggcgtgatcccc
ggcgccggcggcacgcagcgcctgccgcgcgccgtgggcaaggccaaggccatggacatg
accctcaccgcccgcatgatggacgccgccgaggccgagcgcgcgggcctcgtcagccgc
gtcgtgccccaggacaagctcatggaggaagccctgggcgccgccatcgtcatcagcggc
ttctcgcagatcgccgtgatggccgccaaggaatcggtcaaccgcgccttcgagggcacg
ctgtccgacggcgtgatgttcgagcgccgcctgttccactccctgttcgccacccaggac
cagaaggaaggcatggacgccttcgtgaacaagcgcgccccgaacttcacgcaccagtaa

DBGET integrated database retrieval system