KEGG   Alicycliphilus denitrificans BC: Alide_3711Help
Entry
Alide_3711        CDS       T01397                                 

Definition
udp-n-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
adn  Alicycliphilus denitrificans BC
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:adn00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:adn00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3864215..3865720)
Genome map
AA seq 501 aa AA seqDB search
MSAPQALASVDAAVAWLRARVTGTLQTDSRLVAPGDAFIAWPGAATDGRAHVGDAMARGA
VACLVEQEDVEPFGLAGEHIAALPGLKAATGLIAAQWFGRPSERLQVLAVTGTNGKTSTA
WWLADALNGLSKKELPALAGCALVGTLGIGVPPGLSSTGMTTPDPVRLQRAFAQFAQEGL
GACAIEASSIGLAEQRLAGTQISVALFTNLTQDHLDYHSDMAAYWQAKRVLFDWPGLRAA
VVNIDDAHGARLHAELQGGGLDLWSVSIQGPARLQARDIVHRGAGLAFTVAESAQALPLQ
TRLIGLYNVSNLLGVIAGMRALGVPLAQALDACARLAPVPGRMEQLAFAGQPLVAVDYAH
TPDALHQALAALRPMAAQRGGRLWCVFGCGGNRDAGKRPLMGAVAQREADRVIVTSDNPR
GEDPRAIIHQILLGTIAGTSVRAEEDRAAAICLAVAEAEAADVVLIAGKGHEDYQETAGQ
RQPFSDMAHARAALARRGAAA
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcgccgcaggcactggcatccgtggacgcggccgtggcctggctgcgcgcgcgc
gttacgggcacgctgcagaccgacagccggctcgtcgcgcccggcgacgccttcatcgcc
tggcccggcgcggccaccgacgggcgtgcccacgtgggcgatgccatggcgcgtggcgcc
gtggcctgcctggtggagcaggaggacgtggagcctttcggcctcgcgggcgagcacatc
gcggcgcttcccggcctcaaggcagccaccgggctcatcgcggcccaatggttcggccgg
cccagcgaacgcctgcaggtgctggccgtgaccggcaccaatggcaagaccagcaccgcc
tggtggctcgccgatgcgctcaacggactatcgaaaaaggagctgcccgcgcttgcgggg
tgcgccctggtgggcactttggggataggcgtaccgcccggactgagcagcaccggcatg
accacgcccgaccccgtgcgcctgcagcgtgccttcgcgcagttcgctcaagaggggctg
ggggcctgcgccatcgaggcctcgtccatcggcctggccgagcagcgcctggccggcacg
cagataagcgtggcgctgttcaccaacctcacccaggaccacctggactaccactccgac
atggccgcctactggcaggccaagcgcgtgctgttcgactggcccggcttgcgcgcggcc
gtggtcaacatcgacgacgcgcatggcgcgcggctccatgccgaactgcagggaggcggt
ctggacctgtggagcgtctccatccagggcccggcgcggctgcaggcgcgggatatcgtg
caccgcggcgcgggcctggccttcaccgtggccgagagcgcgcaggccttgccgctgcag
acgcggctcatcggcctgtacaacgtgtccaacctgctgggtgtgattgccggcatgcgc
gccctgggcgtgccgttggcgcaggcgctcgacgcctgtgcgcggctcgcgcccgtgccc
ggccgcatggagcaactggccttcgcgggccagcccctggtggccgtggactatgctcac
acgcccgacgcgctgcaccaggcgctggcggcgctgcggcccatggcggcgcagcgcggc
ggccggctgtggtgcgtgttcggctgcggcggcaaccgcgacgcgggcaagcgcccgctg
atgggcgccgtggcgcagcgcgaggcggaccgcgtcatcgtcaccagcgacaacccgcgc
ggcgaggacccgcgtgccatcatccaccagatcctgctgggcacgatcgccggtaccagc
gtgcgcgccgaggaagaccgcgccgccgctatttgcctggccgtggccgaggccgaagcc
gccgacgtggtgctgatcgccggcaagggccacgaggactaccaggagacggccggccag
cgccagccgttttccgacatggcgcatgcgcgcgccgcgctcgcgcgccgaggagccgca
gcatga

DBGET integrated database retrieval system