KEGG   Alicycliphilus denitrificans BC: Alide_3976Help
Entry
Alide_3976        CDS       T01397                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
adn  Alicycliphilus denitrificans BC
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adn00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Alide_3976
Enzymes [BR:adn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Alide_3976
Exosome [BR:adn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Alide_3976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4148858..4150363
Genome map
AA seq 501 aa AA seqDB search
MTYLLALDQGTSSSRSIVFDAQGRVVAQAQQELPQIYPRPGWVEHDPREIWRTQLATARE
ALARAGLSAGGIHALGITNQRETTVLWNRATGQPVHHAIVWQDRRAEPACARLRAQGHAG
LIQSRTGLLIDAYFSATKLQWLLDNVPGARAQAERGELAFGTVDSWLIWQLTGGRRHVTD
VSNASRTMLLNVHTNQWDEELLALLRIPRALMPEVLPSASDFGATDPGLLGGAIAIGGVA
GDQQAALFGQACFSAGMAKNTYGTGCFMLMHTGGSFQKSENGLLTTSAAQPDRQAQFALE
GSVFVGGAVVQWLRDGLRAIPASSEVQALAESVPDSGGVMMVPAFTGLGAPYWKPDARGT
ITGLTRGTTLAHIARAALESIAYQSAALLGAMSRDAVAAGSAPVSELRVDGGACVNDLLM
QFQADLLGIPVVRPACVETTALGAAYLAGLSSGVYASQEELARLWRAERRFVPTLPRDQA
EALMARWEHAVAQAVLPAPGA
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgacctacctgctcgccctcgaccaaggcacctccagttcgcgcagcatcgtcttcgac
gcccagggccgcgtggtggcgcaggcgcagcaggagctgccgcagatctacccgcggccc
ggctgggtggagcatgacccgcgcgagatctggcgcacccagctcgccaccgcgcgcgag
gccctggcgcgggcgggcctgtcggcgggcggcatccacgcgctgggcatcaccaaccag
cgcgagaccacggtgctgtggaaccgcgcgacgggccagcccgtacaccacgccatcgtc
tggcaggaccggcgcgccgagcccgcgtgcgcgcggctgcgcgcgcagggccatgccggc
ctgatccagtcgcgcaccggcctgctgatcgacgcgtacttctcggccaccaagctgcaa
tggctgctggacaacgtgcccggcgcccgcgcgcaggccgagcgcggcgagctggccttc
ggcacggtggacagctggctgatctggcagctgaccggcgggcgccgccacgtcaccgac
gtgagcaacgccagccgcaccatgctgctgaacgtgcacaccaaccagtgggacgaagaa
ctactggcgctgctgcgcatcccgcgcgcgctcatgcccgaggtgctgccctccgccagc
gacttcggcgcgaccgaccccggcctgctgggcggcgcgatcgccatcggtggcgtggcc
ggcgaccagcaggccgcgctgttcggccaagcgtgcttttccgcaggcatggccaagaac
acctacggcacgggctgcttcatgctcatgcacacgggcggcagcttccagaagagcgag
aacggcctgctgaccaccagcgcggcgcagccggaccggcaagcccagtttgcgctcgaa
ggcagcgtcttcgtgggcggcgccgtggtgcagtggctgcgcgacgggctgcgcgccatc
ccggccagcagcgaggtgcaggcgctcgccgagagcgtgcccgactcgggcggcgtgatg
atggtgcccgccttcaccggcctgggcgcgccgtactggaagcccgacgcgcgcggcacc
atcacgggcctgacgcgcggcaccacgctcgcgcacatcgcgcgcgcggcgctcgaatcc
atcgcctaccagagcgcggcgctgctcggcgccatgagccgcgacgccgtggccgccggc
agcgcgcccgtctccgagctgcgcgtggacggcggcgcctgcgtgaacgacctgctcatg
cagttccaggccgacctgctgggcattcccgtggtgcgcccggcctgcgtggagaccacg
gcgctcggcgccgcctacctggcgggcctgtccagcggcgtctacgccagccaggaggag
ctggcgcggctgtggcgcgccgaacgccgcttcgtgcccaccctgccgcgcgaccaggcc
gaggcgctcatggcgcgctgggagcatgccgtggcgcaggcggtgctgcccgcgccaggg
gcctga

DBGET integrated database retrieval system