KEGG   Alicycliphilus denitrificans BC: Alide_4093Help
Entry
Alide_4093        CDS       T01397                                 

Definition
malate synthase g (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
adn  Alicycliphilus denitrificans BC
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:adn01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:adn00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:adn00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4273216..4275414
Genome map
AA seq 732 aa AA seqDB search
MTARTQVHGLQVANELHAFINQQVLPGTGVDPAAFWKGFDAIVADLAPKNAALLAERDRL
QKELDTWHKANPGPITDMVGYRAFLSRIGYLVEPPKGAKASTANVDAELAIQAGPQLVVP
ILNARYALNAANARWGSLYDALYGTDVIGEEGGAEKGKGYNPVRGAKVIEFARNFLDQAA
PLASGSHKDATAYRVEGGKLAVALKDGGATGLKDAAQFVGYQGDAAAPSSVLLVNNGLHI
DIRIDRGTPIGKGDAAGVADVVVEAALSTILDLEDSVAAVDAEDKVLGYGNWLGILKGTL
TETFEKGGKAMTRGLNPDREYTGADGRPVKLHGRSLMFVRNVGHLMTNPAILWGAEGKEI
PEGILDAVVTTAIALHDLKGLGTPGIRNSRTGSVYIVKPKMHGPAEVAFANELFGRVELL
LGLPDSTVKLGIMDEERRTSVNLQACIAAASTRVAFINTGFLDRTGDEMHTAMHAGPMIR
KGDMKTSAWIQAYEKNNVLVGLSMGLRGKAQIGKGMWAMPDLMKAMLEQKIAHPKAGANT
AWVPSPTGATLHALHYHQVKVSDIQQELEKIDALAERDNLLAGLLTVPVTASPNWSEQEK
QQELDNNIQGILGYVVRWVDQGVGCSKVPDINDVGLMEDRATLRISSQHVANWLLHGIVT
EGQVRATFERMAAKVDQQNGGDPLYQRMHGRFGESMAYQAACDLVFKGVEQPSGYTEPLL
HAWRLKVKAAAA
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacgtacccaagtccatggcctgcaggtggccaacgaactgcacgccttcatc
aaccagcaggtgctgcccggcactggcgtcgatcctgcggccttctggaagggttttgac
gccatcgtcgccgatctcgcgcccaagaacgccgccctgctggccgagcgcgaccgcctg
cagaaggaactggacacctggcacaaggccaaccccggccccatcacggacatggtgggc
taccgcgccttcctctcgcgcatcggctacctcgtcgagccgcccaagggcgccaaggcc
agcacggcgaacgtggatgccgagctggccatccaggccggcccgcagctcgtggtgccc
atcctgaacgcgcgctatgcgctcaacgcggccaatgcgcgctggggctcgctctacgac
gcgctctacggcaccgacgtgatcggcgaggagggcggcgccgagaagggcaagggctac
aaccccgtgcgcggcgcgaaagtgattgaattcgcgcgcaacttcctggaccaggccgcg
ccgctggcctccggctcgcacaaggacgccacggcctacagggtggagggcggcaagctg
gccgtcgcgctcaaggatggtggcgccaccggcctgaaggacgccgcgcagttcgtaggc
taccaaggtgacgcggcagcgccctcgtccgtgctgctggtgaacaacggcctgcacatc
gacatccgcatcgaccgcggcacccccatcggcaagggcgatgccgccggcgtggccgac
gtggtggtggaggcggccctgtccaccatcctcgacctggaggactccgtcgccgccgtg
gatgccgaggacaaggtgctgggctacggcaactggctgggcatcctcaagggcacgctg
accgagaccttcgagaaaggcggcaaagccatgacgcgcggtctgaaccccgaccgcgag
tacacgggcgccgacggcaggccggtgaaactgcacggccgctcgctgatgttcgtgcgc
aacgtgggccacctgatgaccaaccccgccatcctgtggggcgccgagggcaaggagatc
cccgagggcatcctggacgccgtggtcaccacggccatcgcgctgcacgacctcaagggc
ctgggcacgccgggcatccgaaacagccgtacgggcagcgtctacatcgtcaagcccaag
atgcacggcccggccgaggtggccttcgccaacgagctgttcggccgcgtcgagctgctg
ctgggcctgcccgacagcaccgtcaagctcggcatcatggacgaggagcgccgcacctcg
gtcaacctccaggcctgcatcgccgccgccagcacccgcgtggccttcatcaacacgggc
ttcctcgaccgcacgggcgacgaaatgcacaccgccatgcacgccggccccatgatccgc
aagggcgacatgaagaccagcgcctggatccaggcctatgagaagaacaacgtgctcgtg
ggcctgtcgatgggcctgcgcggcaaggcccagatcggcaagggcatgtgggccatgccg
gacctgatgaaggccatgctggagcagaagatcgcccatcccaaggcgggcgccaacacc
gcctgggtgcccagccccacgggcgccacgctgcacgccctgcactaccaccaggtgaag
gtgagcgacatccagcaggagctggagaagatcgacgccctggccgaacgcgacaacctg
ctggccggcctgctcaccgtgcccgtgaccgcctccccgaactggagcgagcaggaaaag
cagcaggagctggacaacaacatccaaggcatcctgggctacgtggtacgctgggtggac
cagggcgtgggctgctccaaggtgcccgacatcaacgacgtgggcctgatggaagaccgc
gccaccctgcgcatctccagccagcacgtcgccaactggctcctgcacggcatcgtgacc
gaaggccaggtgcgcgccaccttcgagcgcatggccgccaaggtggaccagcaaaatggc
ggcgacccgctgtaccagcgcatgcacgggcgcttcggcgaatccatggcctaccaggcg
gcctgcgacctggtgttcaagggcgtcgagcagcccagcggctacaccgagccgctgctg
catgcctggcgcctgaaggtcaaggcggctgccgcctga

DBGET integrated database retrieval system