KEGG   Alicycliphilus denitrificans BC: Alide_4322Help
Entry
Alide_4322        CDS       T01397                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
adn  Alicycliphilus denitrificans BC
Pathway
adn00010  Glycolysis / Gluconeogenesis
adn00620  Pyruvate metabolism
adn00640  Propanoate metabolism
adn00680  Methane metabolism
adn01100  Metabolic pathways
adn01110  Biosynthesis of secondary metabolites
adn01120  Microbial metabolism in diverse environments
adn01130  Biosynthesis of antibiotics
adn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:adn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Alide_4322
   00620 Pyruvate metabolism
    Alide_4322
   00640 Propanoate metabolism
    Alide_4322
  Energy metabolism
   00680 Methane metabolism
    Alide_4322
Enzymes [BR:adn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Alide_4322
Lipid biosynthesis proteins [BR:adn01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Alide_4322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ADV02023
JGI: Alide_4322
UniProt: E8TYL4
Position
complement(4529936..4531486)
Genome map
AA seq 516 aa AA seqDB search
MPRLTDSQSYADAQAYFSAEKLWELFDGDRERLNIAHECVDRHADSGRDALIVAHADGAD
EVITYRELAEDSSRFAHYLERRGIQRGQRVAIMLDPSRAFYTAMFGVIKRGAIAVPLFTL
FGPDGIRLRVHDCQPALIVTNAQKMPVAVSATQVPALVYDDAFHASLQGLPPRYAVQTRA
DDLAVFQYTSGTTRELPDAVKHTHRALVTLTVAALYGTGLRPGDRFFCPSSPAWGHGLWH
GTLAPLGMGLTVGAYSGRFHPERLLQALSRHRFTNMSAAATHYRMMKNCGKAGDYAYCFG
KLSFTGEPIDDDTADFVRRTFGLEVCSMYGTTEIGVVLASYPGAPDFPVKRGSLGKPVPG
TRIEVHDAEGRPCPPGATGQLMVLRKGEWIPTKDLGRVDEDGYYYHAGRADDVIISAGWT
MSAVEIENAILLHPDVLEAAAIGVPDEVRGQVVKAFVVTGRAPGEPFVQEIQELVRSKLS
QHEYPRHVAFVPELPKTPAGKVHRKVLREREAAAAH
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgccccgactcaccgattcccagagctatgcggacgcccaggcgtatttctcggccgag
aaactctgggagcttttcgatggcgaccgcgagcgcctcaacatcgcccacgagtgcgtg
gaccggcacgcggacagcggccgcgacgcgctgatcgtggcccacgcggacggcgccgac
gaggtcatcacctaccgcgagctggccgaggattcgtcgcgcttcgcgcactacctggag
cggcgcggcatacagcgcgggcagcgcgtggcgatcatgctcgatccctcgcgcgccttc
tacacggcgatgttcggcgtcatcaagcgcggcgccatcgccgtgccgctgttcacgctg
ttcgggcccgacggcatccgcctgcgcgtccatgactgccagcccgcgctgatcgtcacc
aacgcgcagaagatgccggtcgccgtctcggcgacgcaggtgccggcgctcgtctacgac
gacgcgttccacgccagcctgcaggggctgcccccgcgctacgcggtgcagacgcgcgcc
gacgacctggcggtgttccagtacacctcgggcacgacgcgcgagctgcccgatgccgtg
aagcacacgcaccgggcgctggtcacgctcacggtggcggcgctgtacggcacgggcctg
cggccgggcgaccggttcttctgcccctcgtcgcccgcatgggggcacggcctgtggcac
ggcacgctggcgccgctgggcatggggctcacggtgggcgcgtacagcgggcgctttcat
cccgagcggctgctgcaggcgctgtcaaggcaccgtttcaccaacatgtcggccgccgcc
acgcactaccgcatgatgaagaactgcggcaaggcgggcgactacgcctactgcttcggc
aagctctcgttcaccggcgagcccatcgacgacgacacggccgatttcgtgcgccggacc
ttcggcctggaggtctgcagcatgtacggcaccaccgagatcggcgtggtgctggcgagc
taccccggcgcgccggacttccccgtcaagcgcggctcgctcggcaagcccgtgccgggc
acgcgcatcgaggtgcacgacgccgagggccgcccctgcccgcccggcgccacgggccag
ctcatggtgctgcgcaagggcgagtggataccgaccaaggacctgggccgcgtggacgag
gacggctactactaccacgcgggccgcgccgacgacgtgatcatctccgccggctggacc
atgagcgcggtggagatcgagaacgccatcctgctgcaccccgacgtgctcgaggctgcc
gccatcggcgtgcccgacgaggtgcgcggccaggtcgtcaaggccttcgtcgtcaccggc
cgcgcacccggcgagccgttcgtgcaggagatccaggagctggtgcgctccaagctcagc
cagcacgaatacccgcgccacgtggccttcgtgcccgagctgcccaagacccccgccggc
aaggtgcaccgcaaggtgctgcgcgagcgcgaggccgccgccgcgcattga

DBGET integrated database retrieval system