KEGG   Achromobacter denitrificans: APT56_19020Help
Entry
APT56_19020       CDS       T04244                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
adt  Achromobacter denitrificans
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:adt00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    APT56_19020
   00630 Glyoxylate and dicarboxylate metabolism
    APT56_19020
   00640 Propanoate metabolism
    APT56_19020
   00650 Butanoate metabolism
    APT56_19020
  Lipid metabolism
   00071 Fatty acid degradation
    APT56_19020
   00072 Synthesis and degradation of ketone bodies
    APT56_19020
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    APT56_19020
   00310 Lysine degradation
    APT56_19020
   00380 Tryptophan metabolism
    APT56_19020
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    APT56_19020
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    APT56_19020
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    APT56_19020
Enzymes [BR:adt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     APT56_19020
Exosome [BR:adt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   APT56_19020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
4268661..4269842
Genome map
AA seq 393 aa AA seqDB search
MFDHSGVSIVGSGHTPFGKLDALNLEQLIVMAANEAIEDAGVDPAEIDAIYLGHFNAGLV
PDAFPASLVHQAHPALRFKPATRCENACASGSAAIHAGLRAIQSGAAGTVLVIGVEKMTS
RTTPEVTEALACAGYKNDPRESAMSFPQQFARLAEQYADRYDDPLPVMAAIAAKNHANAL
RNPLAQLRRELDADFCNTISERNPMIASPLRMTDCSPISDGAAAVILTCERRAPRYARQV
RFRAATQVNDMLPLEGRDLLAFEGPHRAMQRAYSDAGVQLQDLDFAEVHDCFTIAELLIY
EAMGLAAPGEGHRVLAEGTVRRDGDLPVNLSGGLKAKGHPVGATGVSMHALAYRQLTGRA
GQMQRPGAELGLVFNMGGMAVANYASVLEAVRA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgttcgatcattcgggcgtttcgatcgtgggcagcggccatacgccgttcggcaaattg
gacgctctgaatcttgagcagctcatcgtgatggcggccaacgaggcgatcgaagacgcc
ggcgtggatccggccgagatcgacgcgatctacctggggcatttcaacgcggggctggtg
cccgatgccttccccgcctcgctggtgcaccaggcgcacccggcgctgcgcttcaagccc
gccacccgttgcgagaacgcctgcgcctcgggctcggccgcgatccatgccggcctgcgc
gccatccagtcgggcgcggccggcaccgtgctggtgatcggcgtcgagaagatgacctcg
cgcaccacgccggaagtgaccgaggcgctggcctgcgccggctacaagaacgatccgcgc
gaaagcgccatgagctttccgcagcagttcgcgcgcctggccgagcaatacgccgaccgc
tacgacgacccgctgccggtcatggccgccattgccgccaagaaccacgccaacgccctg
cgcaatccgctggcgcagctgcggcgcgaactggacgccgacttctgcaacaccatctcg
gaacgcaatccgatgatcgcgtcgccgctgcgcatgaccgactgctcgcccatcagcgac
ggcgccgccgccgtcatcctgacctgcgagcggcgcgcgccgcgctatgcgcgccaggtg
cgctttcgcgccgccacccaggtcaatgacatgctgccgctggagggccgcgacctgctg
gcgttcgagggtccccaccgcgccatgcaacgcgcctattcggatgccggcgtgcagttg
caggacctggattttgccgaggtgcacgattgcttcaccatcgccgaactgctgatctac
gaggccatgggcctggccgcgccgggcgaaggccatcgcgtgctggccgagggcacggtg
cggcgcgacggcgacctgcccgtcaacctgtccggcgggctcaaggccaagggccatccg
gtgggcgccaccggcgtctcgatgcacgcgttggcctatcgccagctgaccggacgcgcc
ggccagatgcaacggcccggcgccgaactcgggctggtgttcaacatgggtggcatggcc
gtcgcgaactacgcgtcggtgctcgaagccgtgcgggcctga

DBGET integrated database retrieval system