KEGG   Arachis duranensis: 107494002Help
Entry
107494002         CDS       T04300                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 1-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
adu  Arachis duranensis
Pathway
adu00052  Galactose metabolism
adu00500  Starch and sucrose metabolism
adu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    107494002
   00500 Starch and sucrose metabolism
    107494002
Enzymes [BR:adu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     107494002
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 107494002
NCBI-ProteinID: XP_015970522
Position
A06
AA seq 576 aa AA seqDB search
MGQLRCIHSLIPVLFLTVVFIISNNGVDAFHKVHPHLQSVSRISVSGKHRTGYHFQPPRN
WINDPNGPMHYNGYYHLFYQYNPKGSVWGNIVWAHSVSKDLINWKALEPAIYPSKPFDKF
GCWSGSATIIPGKGPVILYTGIVDANKTQVQCYAVPEDLSDPFLTKWIKPDEYNPIVVAG
PGVNRTDFRDPTTAWFEDGHWKILVGSRRKHRGIAYLYRSRDFKKWIRAKHPIHTAAGTG
MWECPDFYPVSMKGTMGLDTSVVGNHVKHVLKNSLDETRFEYYTLGTYFTNIDRYIPDNT
SVDGWGGLRYDYGNFYASKSFFDPTMNRRILWGWANESDTKEDDIHKGWAGIQAIPRTLW
LDPGGRQLIQWPIEELNSLRDKEVEMSNLKLVKGDYVEVKGITAAQADVEVTFSFSSLNE
AEAFDLSWVNAEDLCGKKGSNIQGGVGPFGILTLASKNLEEFTPVFFRIFKASNKHVVLL
CSDARSSSLKSELYKPSFAGFVDVDLSTTKKLSLRSLIDHSVVESFGAGGKTNILSRVYP
ELAVADQAHLFVFNNGTVPIVVENLRSWSMKSAVIN
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgggtcaattaaggtgcatccactccttaataccggtcttatttcttactgtggtattc
ataattagcaataatggcgttgacgcttttcacaaagtacacccacatcttcaatctgtt
tcaaggatttctgtgagcggcaaacacagaactggataccattttcaacctcctaggaat
tggattaacgatccaaatggacctatgcactacaatggatactaccatctgttttatcaa
tacaaccctaaaggttcagtgtggggtaacattgtatgggctcactcagtctcaaaagat
ctcatcaattggaaagcacttgagccggccatttatccatcgaaacccttcgacaagttc
gggtgttggtcaggttcagccaccatcatccccggaaaagggccggtgatcctgtacacc
ggaatagtcgacgcgaacaaaactcaagttcaatgctatgccgtcccagaagacttatct
gaccctttcctcacaaaatggatcaaaccggacgagtataatcccatcgtggtcgccggc
cccggcgtcaatcgcaccgacttccgggacccaacaactgcatggttcgaagacggacac
tggaagattttggttggtagtagaaggaagcatagaggaattgcatacttgtataggagt
agggacttcaagaaatggattcgagccaaacaccctattcatactgctgctggaacgggt
atgtgggagtgtccagatttctacccggtttctatgaaggggacaatgggattggatacg
tctgtggttggtaatcatgttaagcatgtgttgaagaatagtcttgatgagactaggttt
gagtattatactttaggtacctatttcaccaatatagataggtatataccggacaacacc
tctgttgatggttggggtggtcttaggtatgattatggtaatttctatgcatccaagtcc
ttctttgaccccactatgaatagaaggatcttgtggggttgggctaatgagtctgatact
aaggaagatgatatccacaaaggatgggcaggaattcaggcaattccaagaactctgtgg
cttgatcctggcggtagacaattgatacaatggcctattgaggaattaaatagccttagg
gataaagaagtagagatgagcaatctaaagcttgtaaagggagattatgttgaagttaaa
ggaattactgctgctcaggcagatgtagaagttaccttctcattttcaagcttgaacgag
gctgaagcatttgatctaagctgggtcaacgcagaggatttgtgtggtaaaaagggttca
aatattcaaggtggggttggaccttttggtattctaacattggcttcaaaaaatttggag
gagtttactcctgtcttctttagaatttttaaagcttcgaacaagcatgtagtgctctta
tgctccgatgcaagaagttcttctttgaagagtgagttgtacaagccatcatttgctgga
tttgtagatgtggatttgtctactactaagaagctttctcttaggagtttgattgatcat
tctgtagtggagagttttggagcaggaggaaaaacaaatattttatctagagtttatcct
gagttagctgtggcagatcaagctcacttatttgtgtttaacaatggaaccgtaccaatc
gttgtggaaaatcttagatcatggagcatgaaatctgctgtcataaattga

DBGET integrated database retrieval system