KEGG   Alkalilimnicola ehrlichii: Mlg_0008Help
Entry
Mlg_0008          CDS       T00391                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aeh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mlg_0008
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mlg_0008
   00052 Galactose metabolism
    Mlg_0008
   00500 Starch and sucrose metabolism
    Mlg_0008
   00520 Amino sugar and nucleotide sugar metabolism
    Mlg_0008
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mlg_0008
   00524 Butirosin and neomycin biosynthesis
    Mlg_0008
Enzymes [BR:aeh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Mlg_0008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
10399..11340
Genome map
AA seq 313 aa AA seqDB search
MSSYLLADIGGTHTRIALATPGGEPQQRHRYRNSELGDPLSGLQHFLAQVAPARPTTLAI
AVAGPVQGGRVQLTNRSWMLHDGSLARALGLDAVHLYNDFQALARALPLLCASSVRPLAP
GVAEPGAPRAVLGPGTGLGVAAAVPCPAGWSALACEGGHVTLAPGDVAESTLIDRLRQQL
DHVSAEAVLCGAGLCRLHAVLHGAPCDDPKAITEAGRAGDPRATETIQRFFSLLGGFAGN
LALTLGARGGLYLAGGMLPALWQPMQESAFLERFRAKGRFRDYLTAIPVLLIRDPEGATL
LGLRALLDDAGGG
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagctcttacctcctggccgacatcggcggcacccatacccgtatcgccctcgcgacg
ccgggcggggaaccgcagcaaaggcaccgctaccgtaacagcgagcttggcgatcccctt
tccggtctgcagcattttctcgctcaggtcgcaccagcccgccccacgaccctggcgatc
gccgtggccggcccggtccagggcgggcgtgttcagttgacgaaccgaagctggatgctg
cacgacggcagcctggcccgcgccctcgggctcgatgccgtgcacctctacaatgacttt
caggcgctcgcccgtgccctccccctgctctgcgcttcctcggtgcggccgttggcgccg
ggtgttgccgagccgggggcgccgcgggcggttctgggtcccggtaccggcttgggggtg
gctgccgccgtgccctgcccggcgggttggtcggcgctcgcctgtgaaggggggcatgtc
accctggcaccgggcgatgtggcggagagcaccctgatcgatcgcctgcggcagcagttg
gatcacgtgtcggcggaggcggtactgtgcggtgccgggctctgccggctgcacgccgtg
ctgcatggggcgccctgtgacgatccgaaggcgatcaccgaggcggggcgcgccggcgat
ccccgggcgactgagaccatccagcggttcttcagcctgcttggcgggtttgccggcaac
ctggcgttgaccctcggcgcccgcggcggtctctaccttgccggagggatgctgccagcg
ctgtggcaaccgatgcaggagtccgccttcctcgagcgcttccgggccaagggacggttt
cgcgattacctcacggccattccggtcctgctcatccgcgacccggagggtgccaccctc
ctcggcctgcgcgccctgctcgatgacgccgggggcggttga

DBGET integrated database retrieval system