KEGG   Alkalilimnicola ehrlichii: Mlg_0282Help
Entry
Mlg_0282          CDS       T00391                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
aeh00900  Terpenoid backbone biosynthesis
aeh01100  Metabolic pathways
aeh01110  Biosynthesis of secondary metabolites
aeh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aeh00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mlg_0282
Enzymes [BR:aeh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Mlg_0282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ABI55637
JGI: Mlg0282
UniProt: Q0AC00
Position
324042..324917
Genome map
AA seq 291 aa AA seqDB search
MSWSRHWPAPAKINLFLHILGRRPDGYHRLQTAFQILDRGDELAFRVRPDGELRRRGGLD
HVPPDQDLTVRAARLLQQTTGCRLGADIVLDKRLPDGGGLGGGSSNAATVLQALNRLWGT
GLSTLELAGLGLRLGADVPVFVHGRTAWAEGVGERLTPIETPSRWFLVVHPGCRVSTAEV
FAAEGLTRDSAPSTISALRAGRVRNDCEPWVRAHYRAVDEALGWLSRFAPARMTGTGACV
FAPFEREAQARAALDRLPAAWQGFVAQGVACSSLLGRLRGEQDSADRDGPT
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgagctggtcccgccactggccggccccggccaagattaaccttttcctgcacatcctc
ggccgccgccccgacggctatcatcggctgcagaccgccttccagatcctggaccggggt
gacgaactggcgttccgggtccgccccgacggtgagctgcggcgccggggcggactggat
cacgtgccgccggaccaggacctgaccgtgcgtgccgcccgcctgctgcaacagaccacc
ggttgccggctcggcgcggacatcgtgctggacaaacgcctgcccgatggcggcggcctg
ggcggcggcagctccaacgccgccaccgtgctgcaagccttgaaccggctctggggcacc
ggcctgtcgaccctggagctggctggcctgggtctgcggctgggcgccgatgtgccggtc
ttcgtgcatggccgaaccgcctgggcggagggggtgggcgagcggcttacccccattgag
accccgtcgcgctggtttctggtggtgcatcccgggtgccgcgtgtccaccgccgaggtc
ttcgccgcggagggtttgacaagggacagcgcgccgagcacaatatcggcccttcgcgcc
gggagggtccgcaatgactgcgagccctgggtgcgtgcccactaccgcgccgtggacgag
gccctgggttggctgtcgcggtttgcgccggcacgcatgaccggcacgggggcctgcgtg
ttcgcgcccttcgagcgcgaggcgcaggcccgggccgcgctggacaggctgccggccgcc
tggcagggtttcgtggcgcaaggcgttgcgtgctcctccttgcttgggcggttgcgtggt
gagcaggacagcgccgacagggatggcccgacatag

DBGET integrated database retrieval system