KEGG   Alkalilimnicola ehrlichii: Mlg_0327Help
Entry
Mlg_0327          CDS       T00391                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aeh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mlg_0327
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mlg_0327
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mlg_0327
Enzymes [BR:aeh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mlg_0327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(373701..375056)
Genome map
AA seq 451 aa AA seqDB search
MSDTKIYLPESDIPRHWYNVIPDMPTPPQPYLGPDGKPITGAAMEAIFPPAIIEQETSSE
RWIPIPEPVREALTLWRPSPLIRARRLEQALNTPAKIYFKYEGVSPAGSHKPNSAVAQAY
YNAEAGIKRLTTETGAGQWGSSLALAGQMFGLDVRIYMVRISYEQKPYRRSMMETWGGEV
IPSPSNHTQAGRDALAQDPDSNGSLGMAISEAVEEAASRGDTNYALGSVLNHVLLHQTVI
GLEAKRQMEIAGDYPDVVFAPCGGGSNVGGIMFPFLADKAAGRDLRLVAVEPASCPTLTR
GHFAYDYGDSVGLTPMMKMYTLGHDFMPPGIHAGGLRYHGDSALVSQLYHDGVLEARSVH
QTATFQAGVLFARTQGIIPAPESAHAIRAAVDEAVQAREEGRERTILFTLSGHGHFDMSA
YDRYFAGELEDMDYPTEALETAKANLPKVEG
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgataccaagatctacctgcccgaatcggacatcccccgtcactggtacaacgtc
attccggacatgccgacgccgccgcaaccctacctggggccggacggcaagccgatcacc
ggcgccgccatggaggccatcttcccgccggccatcatcgagcaggagaccagcagcgag
cgttggatccccatcccggagccggtccgtgaggccctgaccctgtggcggccctcaccg
ttgatccgggcccggcgcctggagcaggcactgaataccccggcgaagatctacttcaag
tacgagggggtgagcccggccggctcccacaaacccaattccgcggtggcccaggcctac
tacaacgccgaagctggtatcaagcggctgaccacggagaccggcgcgggccagtggggc
tcctctctggcgctggccggacagatgtttggcctggacgtacgcatctacatggtgcgt
atcagctacgagcagaaaccctaccgccgctccatgatggagacctggggcggcgaggtc
attcccagcccctccaaccacacccaggccgggcgcgacgccctggcgcaggacccggac
tccaacggctctttgggcatggccatctccgaggcggtcgaggaggccgcctcccggggc
gacaccaactacgctctgggctcggtgctcaaccatgtcctgctccatcagacggtgatc
ggcctggaggccaagcgccagatggagatcgccggcgactacccggacgtggtctttgcc
ccctgcggcggcggctccaacgtcggcgggatcatgttccccttcctggccgacaaggcc
gccggccgtgacctgcggctggtagcggtggagccggcctcctgtccaaccctgacccgc
ggccacttcgcctatgactacggcgacagtgtcggcctgacgccgatgatgaagatgtac
accctgggccacgacttcatgcccccgggcatccacgccggcgggctgcgctaccatggc
gactccgcgctggtctcccagctctaccacgacggtgtgctcgaggcacgctcggtccac
cagaccgccaccttccaggccggggtgctcttcgcccggacccaggggatcatcccggcg
ccggagtcggcgcacgccatccgcgccgccgtggatgaggcggtgcaggcccgggaggag
gggcgggagcgcaccattttgttcaccctctccggccacggccacttcgatatgtccgcc
tacgaccgctatttcgccggtgagctggaggatatggactaccccactgaggccctggag
acggccaaggcgaacctgccgaaggtcgagggttag

DBGET integrated database retrieval system