KEGG   Alkalilimnicola ehrlichii: Mlg_0377Help
Entry
Mlg_0377          CDS       T00391                                 

Definition
3,4-dihydroxy-2-butanone 4-phosphate synthase (EC:3.5.4.25 4.1.2.-)
Orthology
K14652  
3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
Riboflavin metabolism
Metabolic pathways
Module
Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Class
Metabolism; Metabolism of cofactors and vitamins; Riboflavin metabolism [PATH:aeh00740]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
421933..423048
Genome map
AA seq 371 aa AA seqDB search
MAFNSIDEIIEDLREGRMAVILDDEDRENEGDLVMAASMVRPDDINFMARYGRGLICLTL
TRERCEQLRLPLMVQDTEQAQSTNFTVSIEAATGVTTGISAADRARTVQAAVAPHAKPED
LVQPGHIFPLMAQPGGVLTRAGHTEAGCDLARLAGFEPSAVIVEILKEDGTMARRDDLMA
FAREHNLKIGTVADLIAYRVRNERSVERVGECDLPTEHGIFHLYAYQDNVDNALHFALVK
GRPQPDTPTLVRVHVQNTLSDVFASDGPHCGWPLRAAMRQVAEAGEGVVVVLRRRDDSDD
ILKRMRAYQVQASQADESEEARSSSDLRTYGLGAQILTDVGVRRMRVLSAPKRMHAISGF
GMEVVEYVEPE
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcaacagcatcgacgagatcatcgaggacctgcgcgaagggcgcatggcggtc
atcctggacgacgaggaccgggagaacgagggcgacctggtcatggcggccagcatggtc
cggcccgacgacatcaacttcatggcccgctacggccgcggtctcatctgcctgaccctc
acccgcgagcgctgcgagcagctccggctgccgctcatggtccaggacaccgagcaggcc
cagtccaccaacttcaccgtctccatcgaggccgccaccggcgtgaccaccggcatctcc
gccgcggaccgggcgcgcaccgtgcaggccgcggtggcgccgcacgcaaagcccgaggac
ctggtccaaccggggcacatcttcccgctcatggcccagcccggcggcgtgctcacccgc
gccgggcacaccgaggccggctgcgacctggcccgcctggccggtttcgagccctcggcg
gtgatcgtcgagatcctcaaagaggacggcaccatggcccggcgcgacgacctgatggcc
ttcgcccgcgagcacaacctgaagatcggcacggtcgccgacctgatcgcctaccgcgtc
cgcaacgagcgctcggtggaacgggtgggcgaatgcgacctgcccaccgagcacggcatc
ttccacctctacgcctaccaggacaacgtggacaatgccctgcacttcgccctggtcaag
ggccggccccagccggacacccccaccctggtccgggtgcacgtccagaacaccctctcc
gacgtcttcgccagcgatgggccgcactgcggttggccgctgcgcgccgccatgcgccag
gtggccgaggccggggagggcgtggtggtggtgctgcgccggcgcgacgacagcgacgac
atcctcaagcgcatgcgcgcctaccaggtgcaggccagtcaggccgacgagagcgaggag
gcgcgctccagcagtgatctgcgcacctacggcctgggcgcgcagatcctcaccgacgtg
ggcgtgcgccgtatgcgcgtactgtccgcccccaagcgtatgcacgccatttccggcttc
ggcatggaagtggtggaatacgtagagcctgaatag

DBGET integrated database retrieval system