KEGG   Alkalilimnicola ehrlichii: Mlg_0557Help
Entry
Mlg_0557          CDS       T00391                                 

Definition
(GenBank) DNA polymerase III chi subunit, HolC
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
aeh00230  Purine metabolism
aeh00240  Pyrimidine metabolism
aeh01100  Metabolic pathways
aeh03030  DNA replication
aeh03430  Mismatch repair
aeh03440  Homologous recombination
Module
aeh_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:aeh00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Mlg_0557
   00240 Pyrimidine metabolism
    Mlg_0557
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Mlg_0557
   03430 Mismatch repair
    Mlg_0557
   03440 Homologous recombination
    Mlg_0557
Enzymes [BR:aeh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Mlg_0557
DNA replication proteins [BR:aeh03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Mlg_0557
DNA repair and recombination proteins [BR:aeh03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     Mlg_0557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: ABI55911
JGI: Mlg0557
UniProt: Q0AB76
Position
complement(605217..605657)
Genome map
AA seq 146 aa AA seqDB search
MSGQPQPLVRFYVLNRATDPVQRERFACELVAKGLEHGVRHIHIQVHDPQQARRLDTLLW
TFRKESFIPHAVQAEAEDEPVVIGDRPEPRPDALLINLAADIPPEWTAFGRVFEVVVQDP
EILHTTRSHFRTYQQAGVTPEKHDVR
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgggcagccgcaaccgctggtgcgcttctacgtgctgaaccgcgccaccgacccg
gttcagcgggagcgctttgcctgtgagctggtggccaaggggctcgagcacggcgtccgg
catatccatatccaggtgcatgacccgcagcaggcccgccggctggacaccctgctgtgg
accttccgcaaggagagcttcatcccccacgcggtgcaggcggaggccgaggatgagccg
gtggtgatcggcgaccggcccgagccgcggcccgacgccctgctgatcaacctggccgcg
gacatcccgccggagtggacggcattcggccgtgtgttcgaggtggtggtgcaggatccg
gagattctgcacaccacccgcagccacttccgcacctaccagcaggccggtgtcacgccg
gaaaagcatgacgtgcgctga

DBGET integrated database retrieval system