KEGG   Alkalilimnicola ehrlichii: Mlg_0805Help
Entry
Mlg_0805          CDS       T00391                                 

Definition
DNA helicase/exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:aeh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Mlg_0805
Enzymes [BR:aeh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Mlg_0805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
907437..909548
Genome map
AA seq 703 aa AA seqDB search
MPETATHPSSAPDPLQSAAGTLALLEAWVDGGWLRPLDRALAVFLHQHVPQAPPLLLLLA
ALTSHQVGRGHVCLELPALQADPDGTLSLPPEGGAEGAARPSRWLQGLDEAALAAALDCP
ELVQDGPGSSPLVRQEQRLYLRRYWDCEVRIGQALHRRMAAAADWQQGLDGEATRRWLER
LFPAGGGAATDWQRLACALAAGRGFTVITGGPGTGKTTTVLRLLVLLQALQQAAADAPLR
IRMAAPTGKAAARLNASVAGALARLPLDGVADAEALRAAIPTEVVTVHRLLGARPDSRHF
RHRAGEPLPLDVLVVDEASMIDLELMASLLDALPPEARLILLGDKDQLASVEAGAVMGEL
CHRADGGHYTPATTAWLSEVSGESVPADYRDPAGRPLDQHIVMLRHSHRFGADSGIGALA
RAVNGGDAAAVEALWAAGASHPDIARLHLAGPEDPALEALAVAGGADHFAAGASGEGPRG
YRYYLEAMHDGRPRDDAPRSAWDDWARSVLQAQGAFQLLGAVRRGPWGVEALNQRIAAAL
RDAGLVRATSAWYAGRPVIVTRNDYDLGLINGDMGVALAVPEGLAGGAPSDDAGRRDGAR
TVLRVAFLASDGSGRIRWVLPSRLEQVETAYALTVHKAQGSEFRHAALVLPDRVAPVLTR
ELLYTGITRASDWFSLLEPPGGVLVRAIRQRTLRSGGLRTRLV
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagacagccacccatccgtcatccgcaccggacccgttgcagagtgcggccggg
accctggccctgctcgaggcgtgggtggacggcggctggctgcgcccgctggaccgcgcc
ctggccgtcttcctgcaccagcacgtgccccaggcgccgccgttgctgcttctcctggcc
gcgctcaccagccaccaggtcggccgcggccacgtttgcctggaactgcccgcgctgcag
gccgacccggacggcaccctttcgctgccgccggagggcggcgcggagggggccgcgcgc
ccctcccgctggctgcaggggctcgatgaggcggcgctggccgcagcgctggactgcccg
gagctggtgcaggacgggccgggcagtagccccctggtgcgacaggagcagcggctctac
ctgcgccgctactgggactgcgaggtgcggatcggccaggcactgcaccggcgcatggcc
gcggccgcggactggcaacaggggctggatggcgaggccacccggcgctggctggagcga
ctgtttccggctgggggcggggcggccaccgactggcagcggctggcctgcgccttggcc
gccgggcggggcttcaccgtgatcaccggcggccccgggaccggcaagaccaccaccgtg
ctgcggctgctggtgctgctccaggccttgcagcaggcggctgccgatgcgccgttgcgc
atccgcatggccgcccccaccggcaaggccgccgcccggctgaacgcctcggtggccggg
gcgctcgcgcgcctgccgctcgacggcgtggcggatgccgaggccctgcgagcggcgatt
cccaccgaggtggtcaccgtgcaccggctcctgggggcgcggcccgacagccgccatttc
cgccaccgcgccggcgagccgctgccgctggacgtgctagtggtggacgaggcgtccatg
atcgacctggagctcatggccagtctgctggacgcccttccgccggaggcccgcttgatc
ctgctcggggacaaggaccagctcgcctccgtggaggccggcgccgtgatgggcgaactc
tgccatcgggccgacggggggcattacaccccggccaccaccgcctggctctccgaggtc
agcggtgagagcgtcccggcggactaccgggatcccgcggggcggccgctggaccagcac
atcgtcatgctgcgccacagccaccgtttcggcgccgacagcggcatcggcgcgctggcg
cgggccgtcaacggcggtgacgcggcggcggtggaggcgctctgggccgctggcgcttcc
catccggacatcgcacgcctccacctcgcggggccggaggatccggccctggaggcgctt
gccgtggccggcggggcagaccacttcgccgccggcgcttcaggcgaggggccgcggggc
tatcgctactacctcgaggccatgcacgacgggcgcccgcgcgatgatgccccgcgcagc
gcctgggacgactgggcccggtccgtgctgcaggcccagggcgcgttccagttgctgggc
gccgtccgccgcgggccctggggggtggaggccctgaaccagcggatcgccgccgccctg
cgggatgccggcctggtccgcgccacctcggcctggtatgcggggcgtccggtgattgtc
acccgcaacgattacgacctgggcctgatcaacggcgatatgggggtggccctggcggta
ccggaggggctggccgggggcgcaccaagtgatgacgccgggcggcgggacggtgcgcgg
acggtgctgcgggtggcctttctggccagcgacggcagcgggcggatccgctgggtgctg
cccagccggctggagcaggtggagaccgcctacgccctcaccgtgcacaaggcccagggt
tcggagtttcggcacgccgcgctggtgctgccggaccgggtggcgccggtgctcacccgc
gagctgttgtacaccggtatcacccgtgccagcgactggttcagcctgttggagccgccg
ggcggggtgctggtgcgcgccatccgccagcgcaccctgcgcagcggcgggctgcgcacg
cggctggtgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system