KEGG   Alkalilimnicola ehrlichii: Mlg_0958Help
Entry
Mlg_0958          CDS       T00391                                 

Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:aeh00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1092927..1095014)
Genome map
AA seq 695 aa AA seqDB search
MRVYDPHAEAVAFEDGTKLPRRPGSDFFEGPLPAGLSAPYRLRRTSQDGAAHTAHDPYAF
GPALPDYDLHLFGEGRHYHAQRFLGAHPLEHEGVPGVRFAVWAPNAERVSVVGDFNRWDG
RCHPMRVRGGSGVWELFIPGLPDGSLYKFELRNRDSGAVLVKTDPYGRRYQLRPDSAAVV
EPPADYAWNDREWMAARREDQWQSIPISIYEVHLGSWQRAGDGSFLDYRTLAHRLVDHVL
ATGFTHIELLPITEHPFDGSWGYQTTGYFAPTTRFGAPDDFRYFVDHCHRHGIGVILDWV
PAHFPRDDWALANFDGTPLYEHADPRRGEHRDWGTLIFNFGRNEVRNFLTASALYWLEEF
HIDGLRVDAVASMLYLDYSRDEGDWVPNIHGGNENLEAIDFLQELNRITHGEQPGTMIMA
EESTSWPQVTRPTWLGGLGFTMKWNMGWMHDTLTYMGEDPIHRRYHHDQLTFGMLYAFTE
NFVLPFSHDEVVHGKRSLLWRMPGDEWQRFANLRLLYAYQFTYPGKKLLFMGCEFGQGNE
WNAEAALDWYVLDYPLHQGVLRLVGDLNALYREVPALHRHDFDEHGFAWIDCHDTEQSAI
SYLRRDGGHDGEATPPAATVLNFTPVPRHDYRLGVPAPGYWRERLNTDSTHYGGTNLGNG
GGVWAEAVPWMGHPWSVVLTLPPLAGVVLSPEAGP
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgtctacgacccccacgccgaagcggtcgccttcgaggacggcaccaaactgccg
cgccggcccggcagcgactttttcgaagggccactgccggcgggactctccgccccctac
cgcctgcgccggaccagtcaggacggcgcagcgcatacggcgcacgatccttacgccttt
ggcccggcgctgccggactacgatctccacctcttcggtgaggggcgccactaccacgcc
cagcgcttcctgggcgcccatccgctggagcacgagggcgtccccggcgtccgcttcgcc
gtctgggcgcccaacgccgaacgggtcagcgtcgtcggcgacttcaaccgctgggacggg
cgctgccacccgatgcgggtgcgcggcggcagcggcgtctgggagcttttcattcccggc
ctgccggacggttccctctacaagttcgaactgcgcaaccgcgacagcggcgcggttctg
gtcaagaccgatccctacggccgccgctaccagctgcgcccggacagcgccgcggtggtc
gagccgccggcggattacgcctggaatgatcgcgagtggatggccgcccgccgggaagat
cagtggcaatcgatccccatctcgatctacgaggtccacctcggctcgtggcagcgggcc
ggcgacggcagcttcctcgactatcgcaccctggcccaccgcttggtcgaccacgtcctg
gccaccggcttcacccatatcgaactgctgccgatcaccgaacacccattcgacggttcg
tggggttatcaaaccaccggctacttcgcccccaccacccgtttcggcgcccccgacgac
ttccgttacttcgtcgatcactgccaccgccacggcatcggggtgatcctcgactgggtg
ccggcccacttcccccgcgacgactgggcgctggccaacttcgacggcacgccgctctat
gagcacgccgacccgcgccgcggcgagcaccgcgattggggcacgctgatcttcaacttc
ggccgcaacgaggtccgcaactttcttaccgccagcgccctctactggctggaggagttc
catatcgacgggctgcgggtggacgcggtcgcctcgatgctctatctcgactattcacgg
gatgagggcgactgggtgccgaacatccacggcggcaatgagaacctggaggccatcgac
tttctgcaggaactcaaccgcatcacacacggtgaacagccggggacgatgatcatggcc
gaggagtccacctcgtggccccaggtcacccgccccacctggctcggcggcctcggcttc
acgatgaagtggaacatggggtggatgcacgacaccctgacctacatgggcgaggacccg
atccaccgccgctaccaccacgaccaactcaccttcggcatgctctacgccttcaccgag
aacttcgtgctgccgttcagccacgatgaggtggtccacggcaagcggagcttgctctgg
cgcatgccgggcgacgagtggcagcgcttcgccaacctgcgcctgctctacgcctaccag
ttcacctatccaggcaagaagctgctcttcatgggctgcgaattcggccagggcaacgag
tggaacgccgaggcggcgctggactggtacgtcctcgactacccgttgcaccagggggtg
ctgcgtctcgtcggcgaccttaacgccctctaccgggaggtaccggcgctgcaccggcac
gacttcgacgagcacggcttcgcctggatcgactgccacgacaccgagcagtcggccatc
agctacctgcgtcgcgacgggggccacgacggggaggccacgccgccggcggccaccgtg
ctcaacttcaccccggtcccccgccacgactaccggctcggcgtcccggcgccgggctac
tggcgggagcggctcaacaccgattcgacccactacggcggcacgaacctgggcaacggc
ggcggcgtatgggccgaggccgtcccgtggatgggacacccgtggtcggtggtattgacc
ctaccgccgctggccggggtggtgctgtcaccggaagccggcccatga

DBGET integrated database retrieval system