KEGG   Alkalilimnicola ehrlichii: Mlg_0961Help
Entry
Mlg_0961          CDS       T00391                                 

Definition
(GenBank) 4-alpha-glucanotransferase
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
aeh00500  Starch and sucrose metabolism
aeh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aeh00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mlg_0961
Enzymes [BR:aeh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Mlg_0961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_77
Motif
Other DBs
NCBI-ProteinID: ABI56314
JGI: Mlg0961
UniProt: Q0AA23
Position
1098301..1099776
Genome map
AA seq 491 aa AA seqDB search
MSGGGFWQRRRAGVLAHLSSLPGEAGSGSLGRHAHGFIDWLADAGFSVWQMLPLGPTHDD
LCPYQTLSVHAGDARFIDQEALEAVGWLPREPQPSHAPRRWRQERLCRARAGRAAAGDEA
SMAEEAAFRQRHAHWLEDYALYVALRREKGEAPWWEWPTAERDREEAALAAARERLADAI
DQAVFEQFLFFSQWEALRRHAGERGVALFGDMPLFVAHDSADVWAHRDYFQLDEAGRPRT
VAGVPPDYFSDTGQRWGNPHYEWARMQADGFHWWLDRLATQLELFDFVRLDHFRGLAAYW
SIPAEAETARNGQWVPAPGRAFLAAVADRFGRVPLVAEDLGFITEDVEALRDTFGLPGMK
VLHFAFDSDADNPYLPHHHVRDGAVYTGTHDNDTTVGWYQGLDPVVAERVAAYLGYPGEE
MPWPLIRAALASVAGLAVVPMQDLLALDSDHRMNIPGVAGGDNWRWRFQWEWLPEGLQQR
MAEMNRLYGRG
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggggtggattctggcagcggcgccgggccggggttctcgcccacctgagttcg
ctccccggagaggcgggtagcggcagcctcggccgccacgcccacggcttcattgattgg
ctggccgatgccggcttctcggtctggcagatgctgcccctggggccgacccacgacgac
ctctgcccctaccaaaccctctcggtccacgccggtgacgcacggtttatcgatcaagag
gcgctggaggcggtcggctggctaccgcgggaaccgcagccttcccacgccccccgccgt
tggcggcaggagcggttgtgccgggcgcgggccggtcgggccgccgccggcgatgaggcg
tcgatggccgaggaggccgccttccgccaacgccacgcccactggctggaggactatgcg
ctctacgtcgcattgcgccgggagaagggggaggccccttggtgggagtggcccaccgcc
gagcgggaccgggaggaggctgccctggcggcggcccgggagcggctggccgacgccatc
gaccaggccgtcttcgagcaattcctcttcttcagccagtgggaggcactgcgccggcac
gccggcgagcgcggcgtcgcccttttcggcgacatgccccttttcgtcgcccacgacagt
gccgacgtctgggcccaccgggactacttccaactggacgaggccggccgcccccggacc
gtggcgggcgtgccgccggactacttctccgataccgggcaacggtggggcaacccccac
tatgagtgggcgcggatgcaggccgacggcttccactggtggctggatcggctcgccacc
cagttggagctgttcgacttcgtccgcctcgaccacttccgaggcctcgccgcctactgg
tcgatccccgccgaggcggagaccgcccggaacggccagtgggtcccggctcccggccgc
gccttcctggccgcggtggcggaccggttcgggcgggtgccgctggtggccgaagacctc
ggcttcatcaccgaggacgtggaggcgctgcgggacaccttcgggctgccggggatgaag
gtcctccactttgccttcgacagcgacgccgacaacccctacctgccacaccaccacgtc
cgcgacggcgccgtctacaccggcacccacgacaacgacaccaccgtcgggtggtaccag
gggctcgatcccgttgtggcggagcgggtcgccgcctacctggggtaccccggcgaagag
atgccctggccgctgatccgcgccgccctggcctcggtggccggcctggccgtggtgccg
atgcaagatctgctggcgctggactccgaccaccgcatgaacatccccggcgtcgctggc
ggcgacaactggcggtggcgattccagtgggagtggctgccggagggattgcagcagcgc
atggcggagatgaaccggctttacgggcggggctga

DBGET integrated database retrieval system