KEGG   Alkalilimnicola ehrlichii: Mlg_1074Help
Entry
Mlg_1074          CDS       T00391                                 

Definition
(GenBank) nitrous oxide reductase apoprotein
  KO
K00376  nitrous-oxide reductase [EC:1.7.2.4]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
aeh00910  Nitrogen metabolism
aeh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aeh00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Mlg_1074
Enzymes [BR:aeh01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     Mlg_1074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupredoxin_1 COX2 Cu-oxidase_3 UCR_Fe-S_N Copper-bind TAT_signal Cu-oxidase_2
Motif
Other DBs
NCBI-ProteinID: ABI56426
JGI: Mlg1074
UniProt: Q0A9R1
Position
1252757..1254679
Genome map
AA seq 640 aa AA seqDB search
MKEMDTKTTTVDTTNSEESAGLRNPSRRKFLGTTAAVGAVSAAGAAGTGALVRSGEVQAA
DQSILEKIHVGPGDLDEYYGFWSGGHNGEVRVYGVPSMREIMRIPVFNVCSATGYGISNE
SKRILGESSKFLNGDAHHPHISYTDGKHDGRYLFINDKANTRVARVRLDIMKTDKVTTIP
NAQAIHGLRLQKAPKTGYVYCNGEMIIPLPNDGTELEDPKKHFSVWSALDSETMEVAWQV
LVDGNLDNMDSSYCGKYGASTCYNSEHGFTLEEKMRAERDHVVIFNIPRIEEAVENGEYM
TFGDNGVPVVDGRKGSQLTRYIPVPRNPHGLNGSTDGKYFIANGKLSPTVTMIDISRLDD
LFDDKIEPRDAVAGEPELGLGPLHTTFDGRGNAYTTLFIDSQVVKWNMEDAVRHFQGENV
NYIRQKLNVHYQPGHLKATLAESSEADGKWLFSLNKFSKDRFLPVGPLHPENDQMIDISG
EEMKLVHDTPTFAEPHDCVVVRRDQIQTKQIWERDDPYFAETVKMAEEDGVTLTRDNKVI
RDGNKVRVYMTLIAPEFGMNHFRVKQGDEVTVVCTNLDMIQDLTHGFCVCDHGVSIEVSP
QQTASVTFTADKAGVYWYYCNWFCHAMHMEMAGRMIVEPA
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagatggacacaaagaccaccacggtggacaccaccaacagtgaggaatcggcg
ggcctgcggaacccgagccgtcgtaagttcctcggtaccacggctgccgttggggcggtc
agcgccgcgggtgccgccggcaccggtgcgctggttcgctccggtgaggtacaggcagcc
gaccaatccattctagagaagatccacgtagggccgggggatctcgacgagtactacggc
ttctggagcggcggtcacaacggcgaggttcgggtttacggcgtgccgtcgatgcgggag
atcatgcgcatcccggtattcaatgtctgttccgcaaccggctatggcatcagtaacgag
agcaagcggattctgggcgaaagctctaagttcctgaatggcgacgcccaccacccgcat
atcagttacaccgatggcaagcacgacggccggtacctgtttatcaacgacaaggccaat
acccgcgtcgcccgggtccggcttgacatcatgaagacggacaaggtgaccaccatcccg
aacgcccaggcgatccacggcctgcggctgcagaaggcgccgaaaaccggctatgtctac
tgcaacggtgagatgatcattccgttgcccaacgacggcaccgagctggaggatcccaag
aagcacttctccgtctggtccgcgttggattctgagaccatggaggtggcctggcaggtg
ctggtggatggcaacctggacaacatggactccagctattgtgggaagtacggggcatcc
acctgctacaactccgagcacggcttcacgcttgaggagaagatgcgggcggagcgcgac
catgtggtcatcttcaatatcccgcgcatcgaggaggccgtcgagaatggcgaatacatg
accttcggtgacaatggcgtcccggtggtcgatggccgaaagggttctcagcttacccgg
tacatcccggtgccccgtaacccccacggcctgaacggctccaccgacggcaagtacttc
attgccaacggcaagctgtcgcccacggtcaccatgatcgacatttcccgtttggatgac
ctgttcgatgacaaaatcgagccgcgggatgcggtcgccggcgagccggaactgggtctg
gggccactgcatactacttttgacgggcgcggcaacgcctacactacgctgttcatcgac
agccaggtggtcaagtggaacatggaggatgcggtccgccacttccagggcgagaacgtc
aactacatccggcagaagttgaacgtgcactaccagccgggccacctcaaggccacgctg
gccgaatccagtgaagcggacggcaagtggttgttctcccttaataagttctcgaaggac
cgcttccttcccgtggggccgctgcacccggagaacgatcagatgatcgacatctccggc
gaggagatgaagctggtccacgataccccgacctttgcggagccgcatgactgcgtggtg
gttcggcgtgaccagatccagaccaagcagatctgggaacgcgacgatccctacttcgct
gaaacggtgaagatggcggaggaggacggtgtcactctgacccgtgataataaggtcatc
cgtgacggcaacaaagtgcgggtctatatgaccctgattgcgccggagttcggtatgaac
cacttccgggtgaagcagggtgacgaggtgaccgtggtctgcaccaacctcgacatgatc
caggacctcacccacggcttctgtgtgtgtgatcatggggtcagtatcgaggtcagcccg
cagcagacggcatcggtgacctttaccgccgacaaggccggggtctactggtattactgc
aactggttctgccatgccatgcacatggagatggccggtcgcatgatcgtggaacccgcg
taa

DBGET integrated database retrieval system