KEGG   Alkalilimnicola ehrlichii: Mlg_1118Help
Entry
Mlg_1118          CDS       T00391                                 

Definition
MCP methyltransferase/methylesterase, CheR/CheB with PAS/PAC sensor
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:aeh00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mlg_1118
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Mlg_1118
Enzymes [BR:aeh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Mlg_1118
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Mlg_1118
Two-component system [BR:aeh02022]
 CheA family
  CheA-CheYBV
   Mlg_1118
Bacterial motility proteins [BR:aeh02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Mlg_1118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1308051..1310609
Genome map
AA seq 852 aa AA seqDB search
MTLRNANTNLPGIVGLGASAGGLTALEAFFAHARPGRGLAYIVVQHLDPTHKALLPQLLQ
RVTAMPVREAEHGLPVAADHVYVIPPNTELTLAGGALHLAKPMEPRGMRLPVNVLFASLA
SALGGRAIGVVLSGMGSDGTLGMQEIKAVGGLTLAQDPDSAQFDAMPRSAINAGCVDIIA
PADTLATRIQAYVDQVTAPVLPGDEDESPAAPPQPLARIVGLLLRHTRHDFSLYKTSTLH
RRIERRQAVHGINSLAGYADFLENNRQEIDLLFKELLIGVTRFFRDPEVWDYLVETALPA
LLERCGTARPLRAWVVGCSTGEEPYSLAIALREAAERLPHPADFAPQIFASDLSPDAIAT
ARRGEYPLSIADAVTADRLERFFRQHEAHYQVNADIRDQVLFAQHDVVLDPPFTRLDLVV
CRNLLIYFDAALQRKLIPLFHYCLRPDGLLVLGSAETVGRQTHLFEPVQSALRIYSRRDT
RSVERIDFLLNAFPPLTRTTQEHSVSTPNLPADKGDDLKAAADHVLLQVYAPAAVLLNPE
GDIVYISGRTGRYLEPAAGKANWNIHAMARPGLRAPLARALKQANEQLEPVHLHGLALTE
TEKGLTLDITVQSFREPTALQGMTMVVFREVTPQRTAQGQEGSQSAADAAHEAELQQYRD
EIIALREEARVSRDALQSSNEELQSTNEELQSTNEELTTSKEEMQSMNEELQTINSELQA
KLDDLALAQSDMQNVLNSIEIAILFLDQDLNVRRYTERASTIFSLRESDIGRPLSDLTTT
LDYPTLHEDAAETLRTLEASEKQILASDGRWFSVRVIPYRRLDNVIDGVVITLFDITETK
TLEKALRRESRS
NT seq 2559 nt NT seq  +upstreamnt  +downstreamnt
ttgacccttcgcaacgccaacaccaatctgcccggcatcgtcggtctgggcgcgtcagcc
ggtgggctcaccgcgcttgaggcctttttcgcccatgcacggcctgggcgcggtctggcc
tatatcgtcgtccagcaccttgatccaacccacaaggccctgctgccccagctcttgcaa
cgggtgaccgccatgcccgtgcgggaggcggagcacggcctacccgtggcggccgaccac
gtttatgtgatacccccgaacaccgaactgaccctggcgggcggcgcactgcatctggcc
aagcccatggagccccggggtatgcggttgcccgtcaacgtgctgttcgcctccctggcg
agcgcactgggggggcgcgccatcggggtggtcctctccggcatgggctcggacggcacc
ctgggcatgcaggagatcaaggcggtgggtggactgacgctggcccaggaccctgacagc
gcccagttcgacgccatgccgcgaagcgcgatcaacgccggatgcgtcgacatcatcgca
ccggcggataccctggcgacgcgcattcaggcctatgtcgaccaggtgaccgccccggtg
ctacccggtgatgaggacgagagccccgcggccccgccgcaaccgctggcgcgcatcgtc
gggctgctgctgcgccacacgcgacatgacttctcgctgtacaagaccagcaccctgcac
cggcggatcgagcgacgccaggccgtccacggcatcaactcgctggccgggtacgcggac
tttcttgagaacaaccggcaggagatcgacctgctgttcaaggaactgctgatcggggtc
acccgcttcttccgtgacccggaggtctgggactatctggtagagacggcgcttccggcc
ctgctcgaacgatgcggcactgcgcggccgctgcgggcctgggtggtggggtgctccacc
ggcgaagagccctactcgctggcgatcgccctgcgggaggcggcagagcgcttgccccat
cccgccgacttcgcgccgcagatcttcgcctcggacctcagccccgatgccattgccact
gcacgccggggcgagtacccgttgtccatcgccgatgccgtcacggcggaccgcctggaa
cggttcttccgccaacacgaggcccactatcaggtgaacgctgacattcgcgatcaggtg
ctgttcgcgcagcacgacgtggtgctggacccgcccttcacccggctcgacctggtcgtc
tgccggaatctgctcatctacttcgatgcggccttgcaacgcaagttgattccgttgttc
cactattgtctgcggcccgatggcctcctggtgctgggcagcgccgaaaccgtggggcgg
caaacccatctcttcgagcccgtgcaatcggccttgcggatttattcacgacgggacacg
cgttccgttgagagaatcgattttctgctaaacgccttcccgccattgacccggacaacg
caggagcattccgtgtccacgccgaacctacccgccgacaagggcgacgatctgaaggcc
gccgccgaccatgtgctgctccaggtctatgcaccggccgcagtcctgttaaaccctgag
ggcgacatcgtttacatcagtggccgcaccgggaggtatctcgagcccgcggcgggcaag
gccaactggaatatccatgccatggcgcgccccggccttcgggcaccgctcgcccgggcg
ttgaaacaggccaacgagcaattggaaccggtgcaccttcacggcctcgccctgaccgag
acggaaaagggcctgaccctggacattacggtgcagtcctttcgggagccaaccgccctg
cagggcatgaccatggtggtcttccgggaggtgacccctcagcggactgcgcaggggcaa
gagggcagccagagcgcagccgacgccgcccatgaggccgaactgcaacagtatcgcgac
gaaatcatcgccctgcgtgaggaggcccgggtatcgcgggacgcgcttcagtcctccaac
gaggaattgcaatcgaccaacgaagagctgcagtcgaccaacgaggagctcaccacgtcg
aaggaagaaatgcagtccatgaacgaggagctgcaaacgatcaacagcgaactgcaggcg
aaactggacgacctcgccttggcccagagcgatatgcagaacgtcctcaacagtatcgag
atcgccattctgttcctggaccaggacctgaacgtgcggcgctacaccgagcgggcgtcc
accattttcagtttgcgtgaaagcgatatcggccgtcccctgagtgacctgaccaccacc
ctcgactacccgacactacacgaagacgcggcggaaaccctgcgtacactggaggcttcg
gagaagcagatcctggcctccgacgggcgctggttctcagtccgcgtcattccgtatcgc
aggctggataacgtgatcgacggtgtcgtcatcaccctgttcgacattaccgaaacgaaa
acgctggagaaggccctgcgccgggaatcgcggtcctag

DBGET integrated database retrieval system