KEGG   Alkalilimnicola ehrlichii: Mlg_1258Help
Entry
Mlg_1258          CDS       T00391                                 

Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:aeh00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1461194..1461859
Genome map
AA seq 221 aa AA seqDB search
MSDESITVDAGSAALLVVDMQPDFMPGGPLAAPEGDTLVEPIGRLMASGLFRHIIATQDW
HPADHVSFASQQPGRSPFDTIELYGQPQVLWPDHCVQDTPGAALHPDMPWRHATLVLRKA
TDPAVDSYSAFRSNHGPDGRRPPTGLAGYLRDHGVSEVFLCGLARDYCVKWSAEDGAAEG
FACHFLWDLTRPVDPAADDAVRRDLIGAGVRLVESSQLKGA
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgagtccatcacagtcgatgccggctccgcggccctgctggtcgtggacatg
cagcctgacttcatgccgggggggccgttggctgctccggagggggacacgctggtggaa
cccatcggtcggttgatggcctcggggctgtttcggcacatcatcgccacccaggactgg
cacccggccgatcatgtctccttcgccagccagcagcccggtcggtcgcccttcgacacc
attgagctctacggccagccccaggtcctctggcccgaccactgtgtgcaggatactccc
ggcgcagcccttcaccccgatatgccgtggcggcacgccacgcttgttctgcggaaggcc
acggacccggccgtggactcttacagcgcctttcggagcaatcatgggcccgacggccgc
cggccacccaccgggctcgcgggctatctgcgcgatcacggggtcagcgaggtgttcctc
tgcggcctggcccgggactactgcgtcaagtggagcgccgaggacggggccgccgagggt
ttcgcctgtcactttctctgggacctcacgcggccggtggatcccgccgcggatgacgcg
gtgcgccgggatctcatcggcgccggggtgcggttagtcgaatccagtcaactcaagggg
gcctga

DBGET integrated database retrieval system