KEGG   Alkalilimnicola ehrlichii: Mlg_1299Help
Entry
Mlg_1299          CDS       T00391                                 

Definition
GTP cyclohydrolase (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:aeh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mlg_1299
Enzymes [BR:aeh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Mlg_1299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1499890..1500447
Genome map
AA seq 185 aa AA seqDB search
MSERIEAAYRRILQDLGEDPDREGLKDTPARAAKAMRFLTKGYQEDLDQVLNGAVFSSDN
DEMVIVRNIELYSLCEHHLLPFIGRAHVAYLPDGKVIGLSKVARIVDMYARRLQIQENLT
RQIALAVQQVTGGKGVAVYINARHLCMMMRGVEKQNSEMSTSVMLGDFRENPKTRNEFLQ
LIRTP
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcgaattgaagcggcctaccggcgaatcctgcaggacctgggcgaggatccc
gaccgggagggtctgaaagacaccccggcccgggcggcgaaggccatgcgattcctgacc
aagggctatcaggaagacctggaccaggtgctgaacggtgccgtgttcagctccgacaat
gacgagatggtgattgtccgcaacatcgagctgtactccctgtgcgagcatcacctgctt
cccttcattggccgggcgcacgtggcctacctgccggatggcaaggtgatcggcctgtcc
aaggtggcccgcatcgtggacatgtacgcccggcgcctgcagatccaggagaacctcacc
cgccagatcgcactggcggtgcagcaggtcaccggcggcaagggggtggcggtctatatc
aatgcccggcatctgtgcatgatgatgcgtggggtggagaagcagaattccgagatgagc
acctcggtgatgctcggtgatttccgcgagaaccccaagacccgcaacgaattcctgcaa
ctcatccgcaccccctga

DBGET integrated database retrieval system