KEGG   Alkalilimnicola ehrlichii: Mlg_1323Help
Entry
Mlg_1323          CDS       T00391                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aeh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mlg_1323 (gpmA)
   01230 Biosynthesis of amino acids
    Mlg_1323 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mlg_1323 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Mlg_1323 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mlg_1323 (gpmA)
Enzymes [BR:aeh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Mlg_1323 (gpmA)
Exosome [BR:aeh04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Mlg_1323 (gpmA)
  Exosomal proteins of melanoma cells
   Mlg_1323 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1526351..1527049)
Genome map
AA seq 232 aa AA seqDB search
MKKLVLLRHGQSIWNQENRFTGWHDVDLTEKGREEAQAAGQLMKRHGLRFDYAYTSVLKR
AIRTLWIGLDELDQMWIPVTKAWQLNERHYGALTGLNKAETAEEYGAEQVHIWRRSYDTP
PPPLDETSPYHPRHDPRYASLKPEQLPATESLALTLERVLPYWNERIVPTLRDCDNVLIA
AHGNSIRALIKHLDGLDDEAIMKVEIATGDPLVYELDDALAVVDKHYLRERD
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacttgttttactccgccacgggcaaagcatctggaaccaggaaaaccggttc
accggctggcacgacgtcgacctgaccgaaaagggccgggaagaggcccaggccgccggt
cagctgatgaaacggcacggcctgcgcttcgactacgcctacacctccgtgctcaagcgc
gctatccgcacgctctggatcggactggatgagctggaccagatgtggatccccgtcacc
aaggcgtggcaactcaacgagcgccactacggtgcccttactggcctgaacaaggcggag
accgccgaggaatacggcgccgaacaggtccatatctggcgccgcagctacgacactcct
cctcctccgctggacgaaaccagcccctaccaccccaggcacgacccgcgctacgccagc
ctcaaaccggagcagctcccggcgaccgagtccctggccctgaccctggagcgggtcctg
ccctactggaacgaacgcatcgtgcccaccctgcgtgattgcgacaacgtgctgatcgcg
gcccacggcaacagcatccgggccctgatcaaacacctggacgggctggacgacgaggcc
atcatgaaggtggagatcgccaccggcgaccccttggtctacgaactcgatgacgccctc
gcggtggtggacaagcactacctccgggagcgggattga

DBGET integrated database retrieval system