KEGG   Alkalilimnicola ehrlichii: Mlg_1333Help
Entry
Mlg_1333          CDS       T00391                                 

Definition
succinate dehydrogenase subunit D (EC:1.3.5.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:aeh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mlg_1333
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mlg_1333
   00650 Butanoate metabolism
    Mlg_1333
  Energy metabolism
   00190 Oxidative phosphorylation
    Mlg_1333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1532982..1533362
Genome map
AA seq 126 aa AA seqDB search
MNLRTNIKEAQGLGSAKDGVSHWWLQRLTAVALVPLMLWLAFGLARHGGAGYEATVAWVA
NPMTTVLWVLSLAALFWHIKLGLQVVIEDYVHDERAKFASLIAMKFITVLLAAIAILAVL
RVALGS
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgaggacgaatatcaaagaggcgcagggcctgggctctgccaaggacggggtc
agccattggtggctgcaacggctcaccgccgtggccctggttcccctcatgctctggctg
gccttcgggcttgcccgccacggcggggccggctatgaggccaccgtggcctgggtcgcc
aacccgatgaccacggtgctctgggtgctgtccctggcggcgctgttctggcacatcaag
ctgggcctgcaggtggtcattgaggactacgtgcacgacgagagagccaagttcgcgagc
ctgatcgcgatgaaattcatcaccgtgctgctggccgccatcgccatcctggcggtgctg
cgtgtcgcgctggggagctga

DBGET integrated database retrieval system