KEGG   Alkalilimnicola ehrlichii: Mlg_1412Help
Entry
Mlg_1412          CDS       T00391                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aeh00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Mlg_1412
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mlg_1412
  Lipid metabolism
   00071 Fatty acid degradation
    Mlg_1412
  Amino acid metabolism
   00350 Tyrosine metabolism
    Mlg_1412
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mlg_1412
   00626 Naphthalene degradation
    Mlg_1412
Enzymes [BR:aeh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Mlg_1412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1618506..1619522)
Genome map
AA seq 338 aa AA seqDB search
MEAEDTERTTMRVMALEAPGQALQAQSWPVPEPGIGQLRLRVRACAVCRTDLHVVDGELP
DPVLPIIPGHEIVGVVDRVGEGCQRYRPGDRVGVPWLGHTCGTCDHCRAGRENLCDQARF
TGYQLQGGYAEYAIADERFCFPIPAAYTDAGAAPLLCAGLIGHRSLSMAGDDARRLGIYG
FGAAAHIVAQVARHQERDLYAFTRPGDQKAQAFARALGACWAGPSDRLPPKPLDAAIIFA
PVGDLVPQALRAVRKGGRVVCGGIHMSDIPSFPYAWLWGERSLCSVANLTRADGEAFMAL
APEVPVRTEVVEYPLDQANQALDDLRGGRLQGAAVLIP
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggaagcagaggatacggaacgcaccaccatgcgggtgatggcgctggaggccccgggg
caggccctgcaggcccaatcctggcccgtcccggagcccggcatcgggcaactccgcctc
cgggtgcgcgcctgcgccgtctgccgcacggatctgcacgtggtggacggcgagttgccg
gaccccgtactgcccatcatcccgggccatgagatcgtcggtgtggtggaccgcgtgggc
gagggctgccaaaggtaccgcccgggcgaccgggtgggggtgccctggctcggccatacc
tgcgggacctgcgatcattgccgcgccggccgggaaaacctctgcgaccaggcacggttc
accggctaccagttgcagggcggttacgctgaatacgccatcgccgacgagcggttctgc
ttcccgatccccgccgcgtacaccgacgccggcgccgcgccactgttgtgcgccgggctc
atcggtcaccgctcactgagcatggccggcgacgacgcccgccgtctggggatctacggt
ttcggtgcggcggcccatatcgtggcccaggtggcgcgccaccaggagcgcgacctctac
gccttcacccgtccgggggatcaaaaggcccaggcgtttgcccgcgccctcggcgcctgc
tgggccgggccctcggaccggctgccacccaagccattggacgcggccatcatctttgcc
cccgtcggcgacctggtcccccaggccctgcgtgcggtgcgcaagggcggccgggtggtc
tgtggcggcatccacatgagcgatatcccctcgttcccctacgcctggctctggggcgaa
cgcagcctctgctcggtcgccaacctgacccgggccgatggtgaggccttcatggccctt
gcgcccgaggtgccggtacgcacggaagtggtggagtaccccctggaccaggccaatcag
gccctggatgacctgcgcggcggtcgcctgcagggcgccgccgtgctgatcccttag

DBGET integrated database retrieval system