KEGG   Alkalilimnicola ehrlichii: Mlg_1487Help
Entry
Mlg_1487          CDS       T00391                                 

Definition
thiol-disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
aeh  Alkalilimnicola ehrlichii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1700743..1701480)
Genome map
AA seq 245 aa AA seqDB search
MSKTLPVLLVLWSLPMLAWADNVHERIDEALHGLSPELSADAVNETPVDGLYEVIVSGDV
VYMTGDGRFLFQGELVDLESRQSLTELRRGEQRAARIAELGSDQLLIYPANGETRYVVNV
FTDIECPYCQRMHQEIDDYTDKGIEIRYLFMPRAGEGSESYRQSEAVWCAEDRHAAMTKA
KRGEPVESGAECETPIADHLALARELQVRGTPTMISSEGVMQQGYASPENLLQVLEAAAN
SSKQP
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaacccttcccgttctattggtgctctggagtctgcccatgctggcctgggcc
gacaacgtgcacgagcgcatcgatgaggcgcttcatggattgagcccggaactgagtgcc
gatgcggtcaacgagacaccggtggacgggctctatgaggtcatcgtttcgggtgacgtg
gtgtacatgaccggtgacggccggttcctcttccagggcgaactggtggacctggagagc
cggcaatcactcaccgagctgcgccgcggagagcagcgggctgcccggatcgcggagctg
ggcagtgatcagttgctgatctatcccgccaatggtgagacgcgctatgtggtgaatgtc
tttacggacatcgaatgcccctactgccagcggatgcaccaggagatcgacgactacacc
gacaagggcatcgagatccgctacctgttcatgccgcgggccggcgagggcagtgagtcc
tatcggcagtcggaagcggtatggtgcgccgaggaccggcatgccgccatgaccaaggcg
aaacggggcgaaccggtggagagcggggcggagtgcgagaccccgatcgccgatcacttg
gccctggcccgggagctgcaggtgcgcggcacccccaccatgatcagcagcgagggggtg
atgcagcagggctacgcctcgccggagaacctgctgcaggtactggaagcggcggctaac
agcagcaagcagccctga

DBGET integrated database retrieval system