KEGG   Alkalilimnicola ehrlichii: Mlg_1646Help
Entry
Mlg_1646          CDS       T00391                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:aeh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mlg_1646
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mlg_1646
   00630 Glyoxylate and dicarboxylate metabolism
    Mlg_1646
Enzymes [BR:aeh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Mlg_1646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1887193..1889382
Genome map
AA seq 729 aa AA seqDB search
MTQRIEVGGLQVAQELYDLVAKEIAPATGVDADGFWTHLGAIVRDLGARNRELLQKRDEI
QQAIDKWHLERKGQPHDAAAYKTFLEELGYLQPEGEDFEATTENVDPEIAEVAGPQLVVP
INNARFALNAANARWGSLYDALYGSDVLPEDDGAEKGTRYNPVRGKKVMEYAGRVLDEVA
PLAQGRHGDVVAYNLVDDNGRKRLQARLSDGSETGLADPEGLAGYNGAEDDPTVLLLRHN
GLHVEIQIDREHLIGKDHPAGVKDVVMEAAVTAIMDCEDSVAAVDAEDKTAVYRNWLGLM
NGDLETSLEKGGKTIQRRLNADRDYIGADGRALTLPGRSLMLIRNVGHLMTTPAVLDADG
NEIPEGILDGMVTSLIALYDLKGLGRYRNSRSGSMYIVKPKMHGPDEVAFAVELFGRIED
ALGMERNTLKIGVMDEERRTTVNLKACIREAKERIIFINTGFLDRTGDEMHTSMEAGPMI
RKAEMKSSRWLNAYEDWNVDIGLECGLRGRAQIGKGMWTMPDLMKGMMEAKIGHPKAGAN
CAWVPSPTAATLHAIHYHQVNVAEVQDRLAGQRRATLDDLLTIPLEPSPSWSAEEIQQEL
DNNCQGILGYVVRWVDQGIGCSKVPDINNVGLMEDRATLRIASQLLANWLHHGICSEEQI
METMKRMAKVVDQQNAGDPNYRPMAADYDGSVAFQAACELVLKGREQPSGYTEPVLHRRR
REAKAKFGA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgacccaacgtatcgaagtcggcggcctgcaggtcgcccaggagctctacgatctggtt
gccaaggagatcgccccggccactggcgtggacgcggatggtttctggacccacctcggc
gccatcgtacgcgatctgggcgcccgcaaccgtgaactgctgcagaaacgcgacgaaatc
cagcaggcgatcgacaagtggcacctggagcgcaaggggcagccgcacgatgctgcggcg
tataagaccttccttgaggagcttggctacctccagcccgagggcgaggacttcgaggcc
accaccgagaacgtcgacccggagatcgccgaggtggccggcccccagctggtggtgccc
atcaacaacgcccgctttgcgctgaacgccgcgaacgcccgctggggcagcctgtacgac
gcgctctacggttccgacgtcctgcccgaggacgacggcgccgagaagggcacccgctac
aacccggtacgcggcaagaaggtgatggaatatgccggccgggtgctggatgaggtcgca
ccgctggctcaaggccggcacggcgacgtggtggcctacaacctggtggatgacaacggc
cgcaaacggctgcaggcccggctgtcggacggcagcgagaccgggctggccgatccggag
ggcctggcgggttataacggtgctgaggacgaccccaccgtcctgctgctgcgccacaac
ggcctgcatgtggagatccagatcgatcgcgagcacctgatcggcaaggaccaccccgcc
ggcgtgaaggacgtggtcatggaggcggccgtcaccgccatcatggactgcgaggactcc
gtggccgcggtggatgcggaggataagacagcggtctaccgcaactggctgggcctgatg
aacggcgatctggagaccagtctggaaaagggcggcaaaaccatccagcgcagactgaat
gccgaccgcgactacatcggcgccgatggccgcgccctcaccctgcccgggcgcagcctg
atgctgatccgcaacgtcggccacctgatgaccacgccggcggtgctcgacgcggacggc
aacgagatccccgagggcatcctcgacggcatggtcacctccctgatcgcgctatacgac
ctcaagggcctgggccgctaccgcaactcccgctccggcagcatgtacatcgtcaagccg
aagatgcacgggccggacgaggtggccttcgcggtggagctcttcggccgcatcgaggac
gccctgggcatggagcgcaacaccctcaagatcggcgtcatggacgaggaacggcgcacc
accgtcaacctcaaggcctgcatccgggaggcgaaggaacgcatcatctttatcaatacc
ggcttcctcgaccgcaccggcgacgagatgcacacctccatggaggccgggccgatgatc
cgcaaggcggagatgaagagctcccgctggcttaatgcctacgaggactggaacgtggac
atcggcctggagtgcgggctgcgcggccgcgctcagatcggcaaggggatgtggaccatg
ccggacctgatgaagggcatgatggaggccaagatcggccacccgaaggcgggtgccaac
tgcgcctgggtgccctcccccactgcggccaccctgcacgccatccactaccaccaggtc
aacgtggccgaagtgcaggatcggctggccggtcagcggcgggccaccctggatgatcta
ctgaccatcccgctggagcccagccccagctggtccgccgaggagatccagcaggagctg
gacaacaactgtcagggcatcctgggctacgtggtgcgctgggtcgaccagggtatcggc
tgctccaaggtcccggacatcaacaacgtcgggctgatggaggaccgtgccaccctgcgt
atcgccagccagctgctggccaactggctgcaccatggcatctgctccgaggagcagatc
atggagaccatgaagcgcatggccaaggtggtggaccaacagaacgcgggcgaccccaac
taccggcccatggccgccgattacgacggcagcgtggccttccaggccgcctgcgagctg
gtcctcaagggccgcgagcagcccagcggctacaccgaaccggtgctacaccgccgccgt
cgggaggccaaggccaagttcggtgcctga

DBGET integrated database retrieval system