KEGG   Alkalilimnicola ehrlichii: Mlg_1707Help
Entry
Mlg_1707          CDS       T00391                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aeh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mlg_1707
Enzymes [BR:aeh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Mlg_1707
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1953326..1954171
Genome map
AA seq 281 aa AA seqDB search
MSERIDRNALADSLAGRHVAIPESRQLEVLAGLLERRGARVWRCPLVGIHDVANPAPVDD
WLRDFVADPPDLLILLTGEGLRRLLSRCEAIGLRDAFLNALSGTSVLCRGPKPARVLQEL
ALTPDRMAVEATTEGVIRTLNGDELQGRRVAVQLYGTNPNQRLMDYLKKAGAHTTTVAPY
VYADEAEDDEVRQLVVALGEGRLDALILTSSPQVQRLLQVAKAGNLEELLRDGLRQCTVA
AIGPVVARALRERALPVDLMPEHRWFMKPLVQALAKHLGPA
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcggattgaccggaatgcgttagcggatagcctggccggacgccatgtggcc
attcccgagtcccggcaactggaggtgctggccgggctcttggagcgtcgaggcgcccgt
gtctggcggtgcccgttggtgggcattcacgacgtggcgaatccggcaccagtagatgac
tggctgcgcgacttcgtggccgatccgcccgacctgttgatcctgctgaccggggaaggc
ctccgcaggctactgagccggtgcgaggccatcggtttgcgcgacgcattcctgaacgca
ttgagcggcacatccgtgctctgccgggggccaaaacccgcgcgtgtgcttcaggaactg
gccttgacgccggatcggatggccgtcgaggcgaccaccgagggcgttatccggaccctg
aacggcgacgagttgcaaggtcgccgtgttgccgttcaactctacggaaccaaccccaac
cagcggctcatggactatctgaagaaggccggtgcccacaccaccaccgtggcgccctac
gtctacgctgacgaggccgaggacgacgaggtccggcaactggtggtcgccctgggcgaa
ggccgactggatgcgctgatcctgacgagcagcccgcaggtacagcgcctgctgcaggta
gccaaagcaggcaacctggaagagctcctgcgcgatggcctccggcaatgcactgtggct
gccatcgggccggtcgtggcccgagccctgagggagcgggcactgccagtggacctgatg
ccggaacaccgatggttcatgaaacccctggtacaggcactggccaagcacctcggcccc
gcctag

DBGET integrated database retrieval system