KEGG   Alkalilimnicola ehrlichii: Mlg_1821Help
Entry
Mlg_1821          CDS       T00391                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
aeh00260  Glycine, serine and threonine metabolism
aeh00750  Vitamin B6 metabolism
aeh01100  Metabolic pathways
aeh01110  Biosynthesis of secondary metabolites
aeh01120  Microbial metabolism in diverse environments
aeh01230  Biosynthesis of amino acids
Module
aeh_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:aeh00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mlg_1821
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mlg_1821
Enzymes [BR:aeh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mlg_1821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABI57165
JGI: Mlg1821
UniProt: Q0A7M2
Position
complement(2080443..2081579)
Genome map
AA seq 378 aa AA seqDB search
MPFRPRYTGLIAKYHDRLPVKDDSRLISLGEGNTPLIRLNNIPGELGKDVDIYVKYEGLN
PTGSFKDRGMTMAVTKAVEEGSKAIICASTGNTSASAAAYAARAGIKAFVLIPDGKIAMG
KLAQAIMHGADVLQIRGNFDDGMRLVKEVAEQAPVTIVNSVNPYRLQGQKTAAFEIVEEL
ERAPDYHCLPVGNAGNITAHWIGYCEYSGRGEGILTEACTLCNGHCRYASAIVDKRPVMV
GYQASGSAPFLRGHMVDDPETVATAIRIGHPQSWDYAWKVKEESGGWFDECTDQEILEAQ
RLLADREGVFCEPASATSLAGALRDIRHGTIPEGSTVVCTLTGHGLKDPDIAIRQSSDAL
RTIDATLDDVRRAITDRL
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgccgttccgtccgcgttataccggtctcatcgcgaagtaccacgaccgcctgccggtc
aaggatgacagccgcctgatcagtctgggcgagggcaacaccccgctcatccggctcaac
aacatccccggcgagctgggcaaggacgtggacatctacgtcaaatacgaggggctgaac
cccaccggctcgttcaaggaccgcggcatgaccatggcggtgaccaaggcggtggaggag
ggcagcaaggccattatctgcgcctccaccggcaacacctcggcctcggccgccgcctac
gccgcccgtgccggcatcaaggccttcgtgctcatccccgacggcaagatcgccatgggc
aagctcgcccaggcgatcatgcacggcgccgatgtgctgcagatccgtggcaacttcgac
gatggcatgcgtctggtcaaggaggtggcggagcaggccccggtgaccatcgtcaactcg
gtgaacccctaccggctccagggccagaagaccgccgccttcgagatcgtcgaggagctg
gagcgcgcccctgactatcactgcctgcccgtgggcaatgccggcaatatcaccgcccac
tggatcggctactgcgagtactccgggcgcggcgagggcatcctcaccgaggcctgcacc
ctgtgcaacggccactgccgctacgccagtgctattgtcgacaagcgcccggtgatggtg
ggctaccaggccagcggcagcgcgcccttcctgcgcggccacatggtcgacgacccggag
acggtggccaccgccatccgcatcggccatccccagtcctgggactacgcctggaaggtc
aaggaggagtccggtggctggttcgacgagtgcacggaccaggagatcctcgaggcccag
cgactgttggccgatcgcgagggcgtcttctgcgagccggcctcggccacgtctctggcc
ggtgccctgcgcgatatccgccacggcaccatccccgagggcagcacagtggtctgcacc
ctgaccggccacgggttgaaggacccggatatcgccatccgccagtccagtgacgccctg
cgcaccatcgacgccaccctggacgacgtgcgccgggcgatcacggatcgcctgtag

DBGET integrated database retrieval system