KEGG   Alkalilimnicola ehrlichii: Mlg_1821Help
Entry
Mlg_1821          CDS       T00391                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:aeh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mlg_1821
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mlg_1821
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mlg_1821
Enzymes [BR:aeh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mlg_1821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2080443..2081579)
Genome map
AA seq 378 aa AA seqDB search
MPFRPRYTGLIAKYHDRLPVKDDSRLISLGEGNTPLIRLNNIPGELGKDVDIYVKYEGLN
PTGSFKDRGMTMAVTKAVEEGSKAIICASTGNTSASAAAYAARAGIKAFVLIPDGKIAMG
KLAQAIMHGADVLQIRGNFDDGMRLVKEVAEQAPVTIVNSVNPYRLQGQKTAAFEIVEEL
ERAPDYHCLPVGNAGNITAHWIGYCEYSGRGEGILTEACTLCNGHCRYASAIVDKRPVMV
GYQASGSAPFLRGHMVDDPETVATAIRIGHPQSWDYAWKVKEESGGWFDECTDQEILEAQ
RLLADREGVFCEPASATSLAGALRDIRHGTIPEGSTVVCTLTGHGLKDPDIAIRQSSDAL
RTIDATLDDVRRAITDRL
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgccgttccgtccgcgttataccggtctcatcgcgaagtaccacgaccgcctgccggtc
aaggatgacagccgcctgatcagtctgggcgagggcaacaccccgctcatccggctcaac
aacatccccggcgagctgggcaaggacgtggacatctacgtcaaatacgaggggctgaac
cccaccggctcgttcaaggaccgcggcatgaccatggcggtgaccaaggcggtggaggag
ggcagcaaggccattatctgcgcctccaccggcaacacctcggcctcggccgccgcctac
gccgcccgtgccggcatcaaggccttcgtgctcatccccgacggcaagatcgccatgggc
aagctcgcccaggcgatcatgcacggcgccgatgtgctgcagatccgtggcaacttcgac
gatggcatgcgtctggtcaaggaggtggcggagcaggccccggtgaccatcgtcaactcg
gtgaacccctaccggctccagggccagaagaccgccgccttcgagatcgtcgaggagctg
gagcgcgcccctgactatcactgcctgcccgtgggcaatgccggcaatatcaccgcccac
tggatcggctactgcgagtactccgggcgcggcgagggcatcctcaccgaggcctgcacc
ctgtgcaacggccactgccgctacgccagtgctattgtcgacaagcgcccggtgatggtg
ggctaccaggccagcggcagcgcgcccttcctgcgcggccacatggtcgacgacccggag
acggtggccaccgccatccgcatcggccatccccagtcctgggactacgcctggaaggtc
aaggaggagtccggtggctggttcgacgagtgcacggaccaggagatcctcgaggcccag
cgactgttggccgatcgcgagggcgtcttctgcgagccggcctcggccacgtctctggcc
ggtgccctgcgcgatatccgccacggcaccatccccgagggcagcacagtggtctgcacc
ctgaccggccacgggttgaaggacccggatatcgccatccgccagtccagtgacgccctg
cgcaccatcgacgccaccctggacgacgtgcgccgggcgatcacggatcgcctgtag

DBGET integrated database retrieval system