KEGG   Alkalilimnicola ehrlichii: Mlg_1972Help
Entry
Mlg_1972          CDS       T00391                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
aeh00010  Glycolysis / Gluconeogenesis
aeh00051  Fructose and mannose metabolism
aeh00562  Inositol phosphate metabolism
aeh00710  Carbon fixation in photosynthetic organisms
aeh01100  Metabolic pathways
aeh01110  Biosynthesis of secondary metabolites
aeh01120  Microbial metabolism in diverse environments
aeh01130  Biosynthesis of antibiotics
aeh01200  Carbon metabolism
aeh01230  Biosynthesis of amino acids
Module
aeh_M00002  Glycolysis, core module involving three-carbon compounds
aeh_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aeh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mlg_1972
   00051 Fructose and mannose metabolism
    Mlg_1972
   00562 Inositol phosphate metabolism
    Mlg_1972
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Mlg_1972
Enzymes [BR:aeh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mlg_1972
Exosome [BR:aeh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mlg_1972
  Exosomal proteins of bladder cancer cells
   Mlg_1972
  Exosomal proteins of melanoma cells
   Mlg_1972
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABI57314
JGI: Mlg1972
UniProt: Q0A773
Position
complement(2241207..2241959)
Genome map
AA seq 250 aa AA seqDB search
MRKPMVAGNWKMNGSLALVNDMGRALADVDCSAVDVLVCPPFPYIGPLRRAVPDESGVAL
GGQDVSRYDSGAYTGEVAGAMLAEMGCRHVIVGHSERRAMHAETDEVVVDKVQAALRAGL
TPIVCVGETLEARDAGETEQVVGRQLDAVLELGGFVVEKLVLAYEPVWAIGTGRTASPEQ
AQAVHAFIRQRAADALGDELAQRLPILYGGSVKPGNARELFGCADVDGGLIGGASLDPDG
FLEIISAARP
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaagccgatggttgcgggcaactggaagatgaatgggtccctggcgctagtcaac
gacatggggcgggccctggccgatgtcgactgcagcgccgtcgacgtgctggtttgccct
ccgtttccctatatcgggccgctgcgccgcgcggttccggacgagtccggcgtggcgctg
ggcgggcaggacgtctcccgctacgactccggtgcctacaccggtgaggtggcgggtgcc
atgcttgccgaaatgggctgccgccatgtcattgtcggccactcggagcgccgggccatg
cacgccgagaccgatgaggtggtggtcgacaaggtgcaggcggcgctgcgcgccggattg
acgcccatcgtctgtgtcggcgagaccctcgaggcccgggatgctggcgagaccgagcag
gtggtgggtcgtcagttggacgcggtgctcgagttaggcggtttcgtggtcgaaaagctt
gtcttggcctacgaaccggtctgggccatcggtaccggccgcaccgccagcccggagcag
gctcaggcagtgcatgccttcattcggcagcgcgcggccgatgccctcggcgacgagttg
gcccagcgactgcccatcctctacggcggcagcgtcaagccgggcaacgcccgggagttg
ttcggctgcgccgatgtggacggtgggctgatcggcggtgcctcgctcgacccggacggc
tttctggagatcatctctgcggcgcggccctga

DBGET integrated database retrieval system