KEGG   Alkalilimnicola ehrlichii: Mlg_1972Help
Entry
Mlg_1972          CDS       T00391                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aeh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mlg_1972
   01230 Biosynthesis of amino acids
    Mlg_1972
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mlg_1972
   00051 Fructose and mannose metabolism
    Mlg_1972
   00562 Inositol phosphate metabolism
    Mlg_1972
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Mlg_1972
Enzymes [BR:aeh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mlg_1972
Exosome [BR:aeh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mlg_1972
  Exosomal proteins of bladder cancer cells
   Mlg_1972
  Exosomal proteins of melanoma cells
   Mlg_1972
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2241207..2241959)
Genome map
AA seq 250 aa AA seqDB search
MRKPMVAGNWKMNGSLALVNDMGRALADVDCSAVDVLVCPPFPYIGPLRRAVPDESGVAL
GGQDVSRYDSGAYTGEVAGAMLAEMGCRHVIVGHSERRAMHAETDEVVVDKVQAALRAGL
TPIVCVGETLEARDAGETEQVVGRQLDAVLELGGFVVEKLVLAYEPVWAIGTGRTASPEQ
AQAVHAFIRQRAADALGDELAQRLPILYGGSVKPGNARELFGCADVDGGLIGGASLDPDG
FLEIISAARP
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaagccgatggttgcgggcaactggaagatgaatgggtccctggcgctagtcaac
gacatggggcgggccctggccgatgtcgactgcagcgccgtcgacgtgctggtttgccct
ccgtttccctatatcgggccgctgcgccgcgcggttccggacgagtccggcgtggcgctg
ggcgggcaggacgtctcccgctacgactccggtgcctacaccggtgaggtggcgggtgcc
atgcttgccgaaatgggctgccgccatgtcattgtcggccactcggagcgccgggccatg
cacgccgagaccgatgaggtggtggtcgacaaggtgcaggcggcgctgcgcgccggattg
acgcccatcgtctgtgtcggcgagaccctcgaggcccgggatgctggcgagaccgagcag
gtggtgggtcgtcagttggacgcggtgctcgagttaggcggtttcgtggtcgaaaagctt
gtcttggcctacgaaccggtctgggccatcggtaccggccgcaccgccagcccggagcag
gctcaggcagtgcatgccttcattcggcagcgcgcggccgatgccctcggcgacgagttg
gcccagcgactgcccatcctctacggcggcagcgtcaagccgggcaacgcccgggagttg
ttcggctgcgccgatgtggacggtgggctgatcggcggtgcctcgctcgacccggacggc
tttctggagatcatctctgcggcgcggccctga

DBGET integrated database retrieval system