KEGG   Alkalilimnicola ehrlichii: Mlg_1974Help
Entry
Mlg_1974          CDS       T00391                                 

Definition
(GenBank) Dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
aeh00790  Folate biosynthesis
aeh01100  Metabolic pathways
Module
aeh_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:aeh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mlg_1974
Enzymes [BR:aeh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Mlg_1974
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind CdhD
Motif
Other DBs
NCBI-ProteinID: ABI57316
JGI: Mlg1974
UniProt: Q0A771
Position
complement(2243382..2244278)
Genome map
AA seq 298 aa AA seqDB search
MAGSEAGPEAQPPLRLGRFRLPSTRPLVMGVLNVTPDSFSDGGVHLSRAAAIRQARCLVG
QGADIIDIGGESTRPGAEPVPTEQELERVLPVLEAVTGELDVPVSVDTSKPAVMTAAAAS
GAALINDVYALRAPGALAAAADSGLPVCLMHMQGEPRTMQRDPRYRDVVDEVNAFLMARV
RACEQAGIPRARLLLDPGFGFGKSLNHNYTLLGRLDAVCALGPPVLVGMSRKSMLGGVTG
RPVDGRLAAGLAAAVCAVERGARIVRTHDVAPTVDALRVAGAAMAAAQGAPITGQEKQ
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcagtgaagcagggcccgaggcgcagccgccgctgcgcctcgggcgttttcgg
ctgccgtcgacccggcccctggtgatgggggtcctgaacgtcactcccgattccttctcg
gacgggggggtccacctctcccgggcggctgccatccgccaggcccggtgtttggtgggg
cagggcgcggatatcatcgatattggcggtgagtccacccggccgggcgccgagccggtg
ccgacggagcaggaactggagcgggtgctcccggtcctggaggcggtgacgggcgagctc
gatgtgcccgtatcggtggataccagcaagccggcagtgatgaccgcagccgccgcgtcc
ggcgccgccctgatcaacgatgtctatgcgctgcgggcgcccggtgccctggccgccgcc
gccgacagcggtctgccagtgtgcctcatgcacatgcagggtgagccgcggaccatgcag
cgcgacccccgctaccgggatgtggtcgacgaagtcaatgccttcctcatggcacgggtc
cgggcctgcgaacaggccggcatcccgcgcgcacggctgctgcttgatccgggctttggg
tttggcaagagtctcaatcataattacaccctgttgggccggctcgatgccgtctgtgcg
ctggggccgcccgtgctggtgggcatgtcgcgcaaatccatgctggggggcgtcaccggt
cgtccggtggacgggcggctcgccgccggcctggcagcggccgtgtgcgccgtggagcgt
ggcgcgcgcatcgtgcggacccatgacgtggcgccgaccgtggatgcgctgcgggtcgcc
ggggcggcgatggccgcggcacagggagcacccataacggggcaggagaaacagtaa

DBGET integrated database retrieval system