KEGG   Alkalilimnicola ehrlichii: Mlg_2111Help
Entry
Mlg_2111          CDS       T00391                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
aeh00071  Fatty acid degradation
aeh00280  Valine, leucine and isoleucine degradation
aeh00281  Geraniol degradation
aeh00310  Lysine degradation
aeh00362  Benzoate degradation
aeh00380  Tryptophan metabolism
aeh00410  beta-Alanine metabolism
aeh00640  Propanoate metabolism
aeh00650  Butanoate metabolism
aeh00903  Limonene and pinene degradation
aeh00930  Caprolactam degradation
aeh01040  Biosynthesis of unsaturated fatty acids
aeh01100  Metabolic pathways
aeh01110  Biosynthesis of secondary metabolites
aeh01120  Microbial metabolism in diverse environments
aeh01130  Biosynthesis of antibiotics
aeh01200  Carbon metabolism
aeh01212  Fatty acid metabolism
Module
aeh_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:aeh00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Mlg_2111
   00650 Butanoate metabolism
    Mlg_2111
  Lipid metabolism
   00071 Fatty acid degradation
    Mlg_2111
   01040 Biosynthesis of unsaturated fatty acids
    Mlg_2111
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mlg_2111
   00310 Lysine degradation
    Mlg_2111
   00380 Tryptophan metabolism
    Mlg_2111
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mlg_2111
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mlg_2111
   00281 Geraniol degradation
    Mlg_2111
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mlg_2111
   00930 Caprolactam degradation
    Mlg_2111
Enzymes [BR:aeh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Mlg_2111
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Mlg_2111
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Mlg_2111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 THEG
Motif
Other DBs
NCBI-ProteinID: ABI57453
JGI: Mlg2111
UniProt: Q0A6T4
Position
2395968..2398112
Genome map
AA seq 714 aa AA seqDB search
MTTHPKTAQENRPEQETAFHLALGDDGIAVITVDVPGERMNVLKGEMVREANALLDTLDE
QPALRGVIFTSGKADNFIAGADVHMLAACETAEAARELAHAGQRLFDRLEAFPKPVVAAI
HGTCLGGGLELALACHGRVATDHPATRLGLPEVQLGLLPGSGGTQRLPDRVGLPLALDLM
LTGRQLRARQARKRGLVDDLVAPPILLDAARKRIDELAEPRRHRPKRPLTTRLLENNPLG
RRLVYRQSERTVQAKTHGNYPAPPRIIDAVRAGRERGRQAGLETERRHFGELAMTPEARA
LMALYFATTALKKDSGTDAGVEPRPVRRVGVLGAGLMGAGIAYVTSAKAGTPVRLKDIAL
EGLNNGMRHIDGEIRARHKRGALTDFEATRQRTRVTPTLDYRGFGALDVVIEAVFEDPEL
KHRMLADVEAHGPEHVIFASNTSSLPISEIATGAQRPERVIGMHYFSPVEKMPLLEVIAT
DRTDPEVIATTVALGRTQGKTVIVVRDGAGFYVNRILAPYLNEACRLLQEGVAIDHIDRT
LVRFGFPVGPFALLDEVGLDVSEKVAPILHRAFGERMTPVDVGGRMLADGRKGRKSGKGF
YRYDRKRGKGGRPVDEGVYRLLGLAPGRDMAPEAIIDRTVLPMINEAVRCRDEGIIRCER
DGDIGAVFGIGFPPFRGGPFHYLRQQGAAGVTERLQALAAEHGPRFAPAPSLQG
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgcacccgaagacggcacaagagaaccggccggaacaggaaaccgccttccac
ctggccctgggcgatgacggtatcgccgtgatcacggtggatgtgcccggcgagcgcatg
aacgtgctcaagggcgagatggtgcgcgaggccaacgccctgctcgataccctggacgag
cagcctgcgctgcggggcgtgatcttcaccagcggcaaggcggacaacttcatcgccggg
gccgacgtgcacatgctggccgcctgcgagaccgccgaggccgcccgcgagctggcccac
gccgggcagcggctgttcgaccggctggaggcctttccgaaaccggtggtggccgccatc
cacggcacctgcctgggcggcggcctggaactggcgctggcctgccacggccgggtggcc
accgaccacccggcaacgcgcctcggcctgcccgaggtgcaactaggcctgttgcccggc
agcggcggcacccagcgcctgcccgaccgggtggggctgccgctggccctggacctgatg
ctcaccggccgccagctgcgcgcccgccaggcccggaagcgcgggctggtggacgacctg
gtggccccgcccatcctgctggacgccgcccgcaaacggatcgatgagctggccgagccg
cgccgccatcggccgaagcgaccactgaccacccggctgctggagaacaacccgctgggc
cgacggctggtctaccgccagtccgagcgcacggtgcaggccaagacccacggcaattac
ccggccccgccgcgcatcatcgacgcggtgcgcgccggccgggagcggggccgccaggcc
gggctggagaccgagcgccgccacttcggcgaactggccatgacccccgaggcccgggcc
ctgatggcgctctatttcgccaccacggcactgaaaaaggacagcggcaccgatgccggc
gtcgaaccccggccggtgcgacgagtgggtgtgctcggcgccggcctgatgggggccggg
atcgcctacgtcaccagcgccaaggccgggaccccggtgcgcctcaaggacatcgcgctg
gagggcctgaacaacggcatgcgccacatcgacggcgagatccgcgcccggcacaagcgt
ggggcactgaccgacttcgaggccacccgccagcgcacccgcgtcacccccaccctggac
taccgtggcttcggtgccctggacgtggtgatcgaggcggtcttcgaggatccggagctg
aaacaccggatgctggccgacgtggaggcccacggcccggagcatgtcatcttcgccagc
aacacctcgtccctgcccatcagcgagatcgccaccggggcgcaacggccggagcgggtc
atcggcatgcactacttctcaccggtggagaagatgcccctgctggaggtgatcgccacc
gaccgcaccgaccccgaggtcatcgccaccaccgtcgccctgggccggacccagggcaag
accgtgatcgtggtgcgcgacggcgctggcttctacgtcaaccgcatcctcgccccctac
ctcaacgaggcctgccggctgctgcaggagggcgtggccatcgaccacatcgaccgcacc
ctggtgcgcttcggcttcccggtgggccccttcgccctgctggacgaagtggggctggat
gtcagcgagaaggtggcgcccatcctgcaccgggccttcggcgagcgcatgaccccggtg
gacgtgggcgggcggatgctggccgacggccgcaaggggcgcaagagcggtaaggggttc
taccgctacgaccgcaagcgtggcaaaggggggcgcccggtggacgagggggtctaccgg
ctgctcgggctggcaccggggcgcgacatggcaccagaggcgatcatcgaccggaccgtg
ctgcccatgattaacgaggcggtgcgctgccgggatgaagggatcatccgctgcgagcgg
gacggggatatcggtgcagtgttcggcatcggcttcccgccctttcgcggcggccccttc
cactatctgcgccagcagggcgcggccggggtaaccgaacgcctgcaggccctggccgcg
gagcacggcccacgcttcgcgccggccccctcgctccagggctga

DBGET integrated database retrieval system