KEGG   Alkalilimnicola ehrlichii: Mlg_2409Help
Entry
Mlg_2409          CDS       T00391                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:aeh00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Mlg_2409
Enzymes [BR:aeh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Mlg_2409
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Mlg_2409
Lipid biosynthesis proteins [BR:aeh01004]
 Fatty acid synthase
  Component type
   Mlg_2409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2739759..2740373
Genome map
AA seq 204 aa AA seqDB search
MLLRLLLIVLLLGTATASPAEEAPRIAVLGDSLSAAYGLEREREGWVTLLQDRLTAEGHP
HQVINAATSGDTTRQALNRLAPLLEAHSPEVLVVQLGGNDGLRALPPAETRRNLSAIIEM
GQSAGAEVLLVGIRLPPNYGPAYNQRFEALFHELAEDYDVPLVPFLLEGIATDDALMQDD
RIHPNAKAQPKMLELVWPELVPLL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgcgtctcctgctgattgtcctgttactgggcacggccaccgcctcgccggcg
gaggaagccccgcgcatcgcggtgctcggcgacagcctgagcgccgcctacggcctggag
cgcgagcgtgagggctgggtgacgctgctgcaggaccgactgacagccgagggccacccg
catcaggttatcaatgctgccaccagcggcgatacgacccgccaggccctcaaccggctc
gcccccctgctggaggcgcacagccccgaagtgctggtggtgcaactgggcggcaacgac
ggcctgcgcgccctgcccccggcggagacacggcgcaacctgtcggccattatcgagatg
ggacagtcggcgggggcagaggttctgctcgtgggtatacggctgccgcccaattacggg
ccggcctataaccaacgcttcgaggccctgttccatgaactggccgaggactacgacgtg
ccgctggtccccttcctgctggaaggtatcgccaccgatgatgccctgatgcaggacgac
cgcatccaccccaacgccaaggcccagccgaagatgctggagttggtgtggccggagctg
gtgccgttgctctga

DBGET integrated database retrieval system