KEGG   Alkalilimnicola ehrlichii: Mlg_2444Help
Entry
Mlg_2444          CDS       T00391                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:aeh00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Mlg_2444
Enzymes [BR:aeh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Mlg_2444
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2778373..2778984)
Genome map
AA seq 203 aa AA seqDB search
MPGTLYVVSAPSGAGKTSLVNALVRQDEAVSLSVSHTTRPPRPGEEDGVNYHFVDRDRFQ
ALVAQGDFLEHAEVFGNHYGTSRSAVQALLDQGQDVILEIDWQGARQVRERMPGCLSVFI
LPPSREELRRRLTQRGQDEPEVIDRRMAEAVSEMSHYAEYDYLLVNDDFDRTLADLQAIF
TANRHRLERQEPLLAETLRDLLG
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgccaggaaccctctacgttgtgtcagccccctccggagcgggcaagaccagtctggtc
aacgccttggtccgccaggacgaggccgtcagcctgtccgtctctcacaccacccgtccc
ccgcgccccggtgaggaggacggtgtgaactaccatttcgtggaccgggaccgtttccag
gccctggtggcgcagggtgattttctggagcacgcggaggtcttcggcaaccactacggc
acctcgcgcagtgccgtgcaggccctgctcgatcagggccaggacgtgattctggagatc
gactggcagggtgcccgccaggtgcgtgagcgcatgcccgggtgcctctccgtctttatc
ctgcccccctcccgcgaggaactgcgccgccggctcactcagcgtggccaggacgagccc
gaggtcattgaccggcgcatggccgaggccgtcagcgagatgtcccactacgccgaatac
gactacctgctggtcaacgacgacttcgaccgcaccctggccgacctccaggccatcttc
accgccaaccgccatcgcctggaacggcaggagccgctgctggccgagaccctccgcgac
ctgctggggtaa

DBGET integrated database retrieval system