KEGG   Alkalilimnicola ehrlichii: Mlg_2461Help
Entry
Mlg_2461          CDS       T00391                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K18366  
acetaldehyde/propanal dehydrogenase [EC:1.2.1.10 1.2.1.87]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aeh00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Mlg_2461
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mlg_2461
   00650 Butanoate metabolism
    Mlg_2461
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mlg_2461
   00622 Xylene degradation
    Mlg_2461
   00621 Dioxin degradation
    Mlg_2461
Enzymes [BR:aeh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Mlg_2461
    1.2.1.87  propanal dehydrogenase (CoA-propanoylating)
     Mlg_2461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2795811..2796713
Genome map
AA seq 300 aa AA seqDB search
MKIQCAIIGSGNIGTDLMAKLQRSPVLEPAWMVGIDPDSDGLARARAAGLKTTHEGVDGL
LPHIEGDGVRIAFDATSAYVHAENDRKLQEKGVMVIDLTPAAIGPFCVPPVNLKDRIGDG
ATNVNMVTCGGQATVPIVAAVSQVQPVDYAEIVATISSRSAGPGTRKNIDEFTRTTSRAI
EQVGGAKQGKAIIILNPAEPPLIMRDTVHCLVQGKPDHKAITESIERMVAEVQRYVPGYR
IKNGPTFDGQRVSTFLEVEGLGDYLPHYSGNLDIMTAAAARAAEIFAESLQSASDAPATA
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaagatccaatgcgccattatcggctccggcaacatcggcaccgacctgatggccaaa
ctgcaacgcagcccggtgctggaacccgcgtggatggtgggcatcgatccggactccgac
ggtctcgcccgcgcccgtgcggccggcctgaagaccacccacgaaggcgtggacggcctg
ctgccgcacattgagggggacggcgtgcgcatcgccttcgatgccacctccgcctacgta
catgccgagaacgaccgcaagctccaggagaaaggggtcatggtcattgacctgaccccg
gccgccatcgggcccttctgcgtcccgccggtcaatctcaaggaccgaatcggcgacggc
gccaccaacgtcaacatggtgacctgcggcggccaggcgacggtccccatcgtcgcggcg
gtcagccaggtacagccggtggactatgccgagatcgtggccaccatctcctcccggtcc
gccgggccgggcacccgcaagaacatcgatgagttcacccgcaccacctcgcgggccatc
gaacaggtgggcggcgccaaacagggcaaggccatcatcatcctcaatcccgccgagccg
ccattgatcatgcgcgacaccgtgcactgcctggtgcaaggcaaaccggaccacaaggcc
atcaccgagtccatcgaacggatggtggccgaggtgcagcgctacgtaccgggctaccgg
atcaagaatggccccaccttcgacggtcagcgggtgagcactttcctggaggtagagggc
ctgggcgactacctgccccattactccggcaacctggacatcatgaccgcggcagccgcc
cgcgccgccgagatcttcgccgagagcctgcaatcggcgtccgacgcaccggccactgcc
taa

DBGET integrated database retrieval system