KEGG   Alkalilimnicola ehrlichii: Mlg_2473Help
Entry
Mlg_2473          CDS       T00391                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aeh00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mlg_2473
   00052 Galactose metabolism
    Mlg_2473
   00500 Starch and sucrose metabolism
    Mlg_2473
   00520 Amino sugar and nucleotide sugar metabolism
    Mlg_2473
Enzymes [BR:aeh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Mlg_2473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2810354..2811232)
Genome map
AA seq 292 aa AA seqDB search
MTEQRIKKAVFPVAGLGTRFLPATKASPKEMLPVVDRPLIQYAVDEACAAGAETLIFITG
RTKRAIEDHFDKAYELEAELEQKQKHEMLELVRSTVPDGVHCIYIRQGEALGLGHAVHCA
RAVIGDEPFSVLLADDLIDGNGREVLCQMAEQYAEHRSSVLGVERIPNEETHKYGVVSAE
SLGERVYDVNGIVEKPSPAEAPSDLAVVGRYILTPAIFDELARTPPDAKGEIQLTDAIAT
LLRRERVLAYEFSGRRYDCGSKLGYLEATLDYGLKHPELGPAFRDYVARQFR
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgacggagcagcgcatcaagaaagccgtgtttcccgtggccggtctcggtacccgcttt
ctgcccgccaccaaggcgagccccaaggagatgcttccggtggtcgaccggccgctcatc
cagtacgccgtggacgaggcctgcgccgccggtgcggagaccctgatcttcatcaccggg
cgcaccaagcgggccatcgaggatcacttcgacaaggcctacgagctggaggcggaactg
gaacagaagcagaagcacgagatgctggagctcgtgcgttccacggtgccggacggcgtc
cactgcatctacatccgccagggcgaggcgctgggcctggggcacgccgtccattgcgcc
cgcgccgtgatcggcgacgagcccttctcggtgctgctggccgacgacctgatcgacggc
aacggccgcgaggtcctctgccagatggccgagcagtacgccgagcaccgcagcagtgtg
ttgggggtggagcgcatcccaaacgaggagacccacaagtacggggtggtcagtgccgag
tcgctgggcgagcgcgtctacgacgtcaacgggattgtcgagaagccctcgccggcggag
gccccctccgacctcgccgtggtcggccgctacattctcaccccggcgattttcgacgag
ttggcgcgcacgccgccggacgccaagggcgagatccagctcaccgacgccatcgccacc
ctgctgcgccgggagcgcgtgctcgcctacgagttttccgggcggcgctatgattgtggc
agcaagctgggctacctggaggccaccctcgattatgggctgaaacaccccgagctgggg
cctgcctttcgcgactacgtggcccgccagttccggtag

DBGET integrated database retrieval system