KEGG   Alkalilimnicola ehrlichii: Mlg_2494Help
Entry
Mlg_2494          CDS       T00391                                 

Definition
(GenBank) Holliday junction DNA helicase subunit RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
aeh03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:aeh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Mlg_2494
Enzymes [BR:aeh01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Mlg_2494
DNA repair and recombination proteins [BR:aeh03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Mlg_2494
    RecFOR pathway proteins
     Mlg_2494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH Transposase_20 IMS_HHH HHH_3 HHH_8 Cdd1
Motif
Other DBs
NCBI-ProteinID: ABI57834
JGI: Mlg2494
UniProt: Q0A5Q3
Position
2834581..2835207
Genome map
AA seq 208 aa AA seqDB search
MIGRLHGTVAERHPPALLLDVGGVGYELEAPMSTFYALPAGDQAVTLWTHLAVRDDGQAL
YGFASRAERDLFRVLIRISGVGPKLALALLSGMNAEGLQRCIEREDVATLTRLPGVGRKT
AQRLIVELRDRLDGLLPAASGGVPARTGSGEQLDAPAGPQGSREDAVSALVALGYKPAEA
GRLVNAVPGANDLPSEELIRRALQAAVR
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgggcggttgcacggcaccgtcgcggaacgccatccaccggcgctgctactggat
gtggggggcgtgggctatgagctggaggcgcccatgtccaccttctacgccctgcccgcc
ggcgaccaggcggtcactctgtggacccacctggccgttcgcgacgacggccaggccctg
tacgggttcgccagccgcgccgaacgcgacctcttccgggtgctgatccggatcagcggc
gtcgggcccaagctggccctggccctgctctccggcatgaatgccgagggcctgcaacgc
tgcatcgagcgcgaggacgtggccaccctcacccgcctccccggggtgggtcgcaagacc
gctcagcggctgatcgtggaactgcgcgaccggctggacgggctgctgccggccgcatcg
ggcggcgtgcccgcccggaccgggtccggcgaacagctagacgcgccagccggcccccag
gggtcccgggaggatgcggtcagcgccctggtggccctgggttataagcccgccgaggcc
ggccggctggtcaacgccgtgcccggcgccaacgacctgcccagtgaggaactcatccgc
cgcgcgctgcaggcggcggtacgctga

DBGET integrated database retrieval system