KEGG   Alkalilimnicola ehrlichii: Mlg_2608Help
Entry
Mlg_2608          CDS       T00391                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
aeh00020  Citrate cycle (TCA cycle)
aeh00310  Lysine degradation
aeh01100  Metabolic pathways
aeh01110  Biosynthesis of secondary metabolites
aeh01120  Microbial metabolism in diverse environments
aeh01130  Biosynthesis of antibiotics
aeh01200  Carbon metabolism
Module
aeh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aeh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aeh00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mlg_2608
  Amino acid metabolism
   00310 Lysine degradation
    Mlg_2608
Enzymes [BR:aeh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Mlg_2608
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: ABI57948
JGI: Mlg2608
UniProt: Q0A5D9
Position
complement(2957764..2959032)
Genome map
AA seq 422 aa AA seqDB search
MSIEVKVPPLPESVSEATVVAWHKQPGDAVSRDENLVDLETDKVVLEVPAPADGVMGERF
KNEGDTVTADEVLGKLEEGAAPAKAESKPAEAAPAPKQEAASAPAPKPAEAPAAASAPAE
DLADLPPAARRLVEENNLDPKQIPGTGRAGRITKEDVVRFMKGETQPVQQPAAGQPAAAA
APQVSADAADRPEKRVPMTRLRQRIAERLVEAQQTAAMLTTFNEVNMQPVMNTRGQYKDK
FEKTHGIKLGFMSFFVKAAVEALQRFPAVNASIDGKDIMYHGYYDVGIAVSSPRGLVVPV
LRDADQMSFAEIEAKIAEFGQKAREGKLSMEELTGGTFTITNGGIFGSLLSTPILNPPQS
GILGMHKIQERPMAENGQVVIRPMMYLAHSYDHRIIDGREAVQFLVTIKECLEDPTRLLL
EV
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcgaagtcaaagtgccgccgttgccggagtccgtttctgaagccactgtggtc
gcctggcacaagcagccgggcgacgctgtgtcccgggacgagaacctggtggacctggag
accgacaaggtcgtgctcgaggtgcccgccccggccgatggcgtgatgggggagcggttc
aagaacgaaggggacaccgtcaccgccgacgaggtgctgggcaagctggaggaaggggcg
gcccccgccaaggctgagtccaagccggctgaagcggccccggcgcccaagcaggaggct
gcctccgcccccgcgccgaagcccgccgaggcgccggcggctgccagcgccccggccgag
gacctggctgacctgccgccggctgcccggcgcctggtcgaggagaacaacctggacccg
aagcagatccccggcaccggtcgggcgggccgcatcaccaaggaggacgtggtccgcttc
atgaagggcgagacccagccggtccagcagcccgctgcggggcagccggctgccgcggcc
gccccgcaggtctccgccgatgccgccgaccggccggagaagcgggtgcccatgacccgg
ctgcgccagcggatcgccgagcgcctggtcgaggcccagcagaccgccgccatgctcacc
acctttaatgaggtgaacatgcagccggtgatgaacacccgggggcagtataaggacaag
tttgagaagacccacggcatcaagctgggcttcatgtccttctttgtgaaggccgcggtc
gaggccctccagcgcttccccgccgtcaatgcctccattgacggcaaggacatcatgtac
cacggctattacgatgtgggcatcgccgtctcctcgccccgtggcctggtggtgccggtg
ctgcgtgacgccgaccagatgagctttgccgagatcgaggccaagatcgccgaatttggc
cagaaggcgcgcgagggcaagctctccatggaggagttgaccggtggcaccttcaccatc
accaacggcggcatcttcggctcgctgctctccacccccattctcaatccgccgcagagc
ggcatcctgggtatgcacaagatccaggagcggcccatggccgagaatgggcaggtggtg
atccggccgatgatgtacctcgcccactcctacgatcaccggatcatcgacggccgcgag
gcggtgcagttcctggtgaccatcaaggagtgcctggaggatccgacccggctgttgctg
gaagtctga

DBGET integrated database retrieval system