KEGG   Alkalilimnicola ehrlichii: Mlg_2649Help
Entry
Mlg_2649          CDS       T00391                                 

Definition
formamidopyrimidine-DNA glycosylase/DNA-(apurinic or apyrimidinic site) lyase (EC:3.2.2.23 4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:aeh03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2998948..2999781
Genome map
AA seq 277 aa AA seqDB search
MPELPEVETTRRGLAPLLEGRRVTGMTVRQARLRWPVPAGLPDAITGQTIRAVDRRAKYL
LFRTPAGTLILHLGMSGSLRVIPGQQAGACAVPPGRHDHVDLRLADGSCLRYTDPRRFGS
LHWCTGEPEAHWLLHRLGPEPFDTAFDGDRLHRLSRGRRTSVKAFIMDSGIVVGVGNIYA
SESLFRAGIHPGRPAGRVGLARYRRLAGAVREVLAEAIAAGGTTLRDFTASDGRPGYFAQ
TLNVYGRAGAPCPRCGRSIRQRRIAQRSTWYCPGCQR
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagctgcccgaagtggagaccacccggcgcggcctcgccccgctgctggagggc
cggcgtgtaaccggaatgaccgtgcgccaggcccggctgcgctggccggtaccggcgggc
ctgcccgatgccatcaccggccagacgatccgggccgtggaccggcgggccaaatacctg
ctcttccgtaccccggcggggacgctgatcctgcatctggggatgtccggcagcctgcgg
gtgatccccggccagcaggccggcgcgtgcgccgtcccccccgggcgccacgaccatgtg
gacctgcgcctggccgacggcagctgcctgcgctataccgatccgcgccggttcggcagc
ctccactggtgcaccggtgaaccggaggcgcactggctgctccaccggctgggtccggag
cccttcgacaccgccttcgacggcgataggctccaccgcctgagccgcggccggcgaacc
agcgtcaaggccttcatcatggacagcgggatcgtggtgggggtggggaacatctacgcc
agcgagtcgctgttccgggccggcatccacccgggacgcccggccgggcgggtgggcctc
gctcgttaccggcgcctggccggcgccgtgcgcgaggtgctggccgaggccatagccgcc
ggtggcacgaccctgcgggacttcaccgccagcgacggccgccccggctacttcgcccag
accctcaacgtctatggccgggcgggcgcgccctgcccccgctgcggccggtccatccgt
cagcgacgcatcgcacagcgctccacctggtattgcccgggctgccagcgctga

DBGET integrated database retrieval system