KEGG   Alkalilimnicola ehrlichii: Mlg_2778Help
Entry
Mlg_2778          CDS       T00391                                 

Definition
L-fuculose-phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aeh00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Mlg_2778
Enzymes [BR:aeh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Mlg_2778
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3155585..3156211
Genome map
AA seq 208 aa AA seqDB search
MSTAAELLAAARQLEALGLNQGTAGNLSVRSGDGLWITPSALPLEGLAPEDMVYLGLDGR
SQGRHRPSSEWRFHRDILAARPEVGAVVHSHAPYATTLACQRRPVPAFHYMVALAGGHDI
RCSDYATFGTQALSEATLRALEGRRACLLANHGMIALGADLPAALDLAREVEYLCRLYHQ
TLQTGRPRLLDREEMDRVQVRFQDYRRH
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgccgccgagctcctggccgctgcccgccaactcgaggccctgggtctgaac
cagggcaccgccggcaatctcagtgtgcgcagcggcgacggcctctggatcaccccctca
gccctgcccttggagggcctggccccggaggacatggtctacctggggctcgacggccgg
tcgcaaggacgacaccggccctcctcggagtggcgcttccatcgggacatcctggccgcc
cgccccgaggtcggggcggtggtccacagccacgccccctacgccaccaccctcgcctgc
cagcgccggccggtaccggcgttccactacatggtggcgctggcaggcggccacgacatc
cgctgcagcgattacgccaccttcggcacccaggccctgtccgaggccacccttcgggca
ttggaggggcgccgggcctgcctgctggccaatcacggcatgatcgcgctgggcgcggac
ctgcccgccgcgctggacctggcgcgggaggtggaatacctctgccggctctaccaccag
accctgcagaccggccgcccacggctgctcgatcgcgaggagatggaccgcgtgcaggtg
cgattccaggactaccgccggcactga

DBGET integrated database retrieval system