KEGG   Alkalilimnicola ehrlichii: Mlg_2778Help
Entry
Mlg_2778          CDS       T00391                                 

Definition
L-fuculose-phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:aeh00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3155585..3156211
Genome map
AA seq 208 aa AA seqDB search
MSTAAELLAAARQLEALGLNQGTAGNLSVRSGDGLWITPSALPLEGLAPEDMVYLGLDGR
SQGRHRPSSEWRFHRDILAARPEVGAVVHSHAPYATTLACQRRPVPAFHYMVALAGGHDI
RCSDYATFGTQALSEATLRALEGRRACLLANHGMIALGADLPAALDLAREVEYLCRLYHQ
TLQTGRPRLLDREEMDRVQVRFQDYRRH
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgccgccgagctcctggccgctgcccgccaactcgaggccctgggtctgaac
cagggcaccgccggcaatctcagtgtgcgcagcggcgacggcctctggatcaccccctca
gccctgcccttggagggcctggccccggaggacatggtctacctggggctcgacggccgg
tcgcaaggacgacaccggccctcctcggagtggcgcttccatcgggacatcctggccgcc
cgccccgaggtcggggcggtggtccacagccacgccccctacgccaccaccctcgcctgc
cagcgccggccggtaccggcgttccactacatggtggcgctggcaggcggccacgacatc
cgctgcagcgattacgccaccttcggcacccaggccctgtccgaggccacccttcgggca
ttggaggggcgccgggcctgcctgctggccaatcacggcatgatcgcgctgggcgcggac
ctgcccgccgcgctggacctggcgcgggaggtggaatacctctgccggctctaccaccag
accctgcagaccggccgcccacggctgctcgatcgcgaggagatggaccgcgtgcaggtg
cgattccaggactaccgccggcactga

DBGET integrated database retrieval system