KEGG   Alkalilimnicola ehrlichii: Mlg_2845Help
Entry
Mlg_2845          CDS       T00391                                 

Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
aeh00010  Glycolysis / Gluconeogenesis
aeh00030  Pentose phosphate pathway
aeh00051  Fructose and mannose metabolism
aeh00052  Galactose metabolism
aeh00230  Purine metabolism
aeh00500  Starch and sucrose metabolism
aeh00520  Amino sugar and nucleotide sugar metabolism
aeh00521  Streptomycin biosynthesis
aeh01100  Metabolic pathways
aeh01110  Biosynthesis of secondary metabolites
aeh01120  Microbial metabolism in diverse environments
aeh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aeh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mlg_2845
   00030 Pentose phosphate pathway
    Mlg_2845
   00051 Fructose and mannose metabolism
    Mlg_2845
   00052 Galactose metabolism
    Mlg_2845
   00500 Starch and sucrose metabolism
    Mlg_2845
   00520 Amino sugar and nucleotide sugar metabolism
    Mlg_2845
  Nucleotide metabolism
   00230 Purine metabolism
    Mlg_2845
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mlg_2845
Enzymes [BR:aeh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Mlg_2845
    5.4.2.8  phosphomannomutase
     Mlg_2845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV DUF2218 OMPdecase
Motif
Other DBs
NCBI-ProteinID: ABI58185
JGI: Mlg2845
UniProt: Q0A4Q2
Position
complement(3233036..3234445)
Genome map
AA seq 469 aa AA seqDB search
MSEKKDQAPGLPDSIFRTYDIRGIVTQGFNADVARLLGRAIGSEAADQGQRRVIVARDGR
HSSPELVAGLTEGLQQVGRDVIDLGCVPTPLMYFATHHLGTGAGVMVTGSHNPPEYNGMK
IMAGGRTLSGDDIQDLRRRVHEGDYARADAPGTRETYDIVPDYLARVTGDVRPDRPLKVV
LDAGNGVAGAVAPALFRALGCEVEALYCEVDGSFPNHHPDPAEPKNVAELIDRVRAGGAD
VGLAFDGDGDRLGVVDNEGRIIWPDRQLMLYAQDVLSRRPGEPVIFDVKCSAHLARVIRE
AGGEPCMWKTGHSLIKAKLKETGAPLAGEMSGHIFFEERWYGFDDALYTGARLLEILARR
AGSSAEVFAALPDAVSTPELRVNLEEGEPTPLMERLLAAGRERFTDATLHTIDGLRVEFP
DGWGLIRSSNTTPSLVLRFEADDEAALERIKAAFRALLESIRPGLSLPF
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagaagaaggaccaggccccgggcctgccggacagcatcttccgcacctacgac
atccgcggcatcgtcacccagggcttcaatgccgacgtggcccggctgttgggccgggcc
atcggcagcgaggccgccgaccagggccagcggcgcgttatcgtggcccgcgatggccgt
cactccagcccggagctggtggcgggcctgaccgaggggctgcaacaggtcgggcgggac
gtcatcgacctgggctgcgtccccacgccgctgatgtacttcgccacccaccacctgggc
accggcgccggggtgatggtcaccggcagccataatccgccggagtataacggcatgaag
atcatggccggcggccggaccctctccggggacgacatccaggacctgcggcggcgggtg
catgagggtgactacgcccgtgctgatgcccccggtacccgcgagacgtacgacatcgtc
ccggactatctggcgcgggtgaccggtgacgtgcggcccgatcgtccgctcaaggtggtc
ctggatgcgggcaacggcgtcgccggggcagtggccccggcgctgttccgggcgctgggt
tgcgaggtggaggcgctttactgcgaggtggacgggtccttccccaaccaccacccggac
ccggcggagccgaagaatgtcgccgagctgatcgaccgggtgcgggccggtggcgctgac
gtcggcctggcctttgacggcgacggtgaccgcctgggggtggtggacaacgagggccgg
atcatctggccggaccgccagctaatgctctacgctcaggatgtgctctcccgccggccc
ggtgagccggtgatcttcgatgtgaagtgctcagcgcatctggcccgggtgatccgcgag
gcggggggcgagccctgcatgtggaaaacggggcactcgctgatcaaggccaagctcaag
gagacgggcgcacccctggccggtgagatgagcggccacatcttcttcgaggagcgctgg
tacggcttcgacgacgccctctacaccggcgcccgtctgctggagatcctggcccgccgg
gcaggcagcagcgccgaggtcttcgccgccctgcccgacgcggtgagcaccccggagttg
cgggtgaacctggaggagggggagccgacgccgcttatggagcgcctgctggcggccggc
cgcgagcggttcaccgatgccacactgcacaccatcgacggcctgcgggtggagttcccc
gacggctggggcctgatccgcagctccaacaccacgccgagcctggtgctgcgcttcgag
gccgacgacgaggccgcgctggagcggatcaaggcggcgttccgcgccctgctggagagc
atccggccggggctgtcgctgcctttctaa

DBGET integrated database retrieval system