KEGG   Adlercreutzia equolifaciens: AEQU_0424Help
Entry
AEQU_0424         CDS       T02875                                 

Definition
(GenBank) histone acetyltransferase
  KO
K07739  elongator complex protein 3 [EC:2.3.1.48]
Organism
aeq  Adlercreutzia equolifaciens
Brite
Enzymes [BR:aeq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     AEQU_0424
Transfer RNA biogenesis [BR:aeq03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    AEQU_0424
Chromosome and associated proteins [BR:aeq03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    AEQU_0424
   HAT complexes
    Elongator complex
     AEQU_0424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM_C Radical_SAM Acetyltransf_10 Acetyltransf_1 Glyoxalase_4
Motif
Other DBs
NCBI-ProteinID: BAN76393
UniProt: S6BXP1
Position
complement(608213..610189)
Genome map
AA seq 658 aa AA seqDB search
MEEALLEIIEAVRSGVVGGEGADSNADAAWLDKLVRRHNRAAHDGTRQVAKRRLLPFYLR
VKAEEPERWAAWNVSEATDAALVRLLQAKPRRTASGVATITVLTKPWPCSGACVFCPNDI
RMPKSYLSDEPACQRAERCWFDPFLQVAARLRTLTAMGHVTDKVELIVLGGTWSDYPESY
QRWFIGELFRALNLPDEERAREATERQRWYESRGLPRDRDALAAAAASLQQRIDAGELTY
NEAWREAYAAEGPRGHEAEAFPHPGISTAAQRADQGLPLREDAESAAPKELSWDDLFALH
RANETAPKRVVGLVAETRPDLVTADACRSLRALGCTKVQIGIQSLSDDLLAANGRAITSA
RIADAMALLRRFGFKSHVHFMVNLLGADPASDIADYRRLVTDPAFLPDEVKLYPCCLVES
AQLTDCYEAGRWRPYTEEELVRVLVQDVLATPPWTRISRMVRDISATDILAGNKKTNLRQ
VVEAAVDATDEAVAEIRSREISVEGATVGDLSLQTIAYQTATTEERFLEWITPENKIAGF
CRLSLPTALPRDTANESSPPPIKSEQSEARGSSLASPSAPQEAMIREVHVYGKVAALHRT
GEGTQHLGLGRALVEEACAQATAAGYTAINVISAVGTRVYYRNLGFKDAGLYQKRPLP
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagcactcctggaaataatcgaagccgtgcgcagcggcgtcgtcggtggcgaa
ggagccgacagcaacgccgacgccgcatggctcgacaaactggtgcgtcggcacaaccgc
gccgcccacgacggcacgcgccaagtggccaagcggcgactcctccccttctacctgcgc
gtgaaggccgaggagcccgagcggtgggcggcgtggaacgtgagcgaggcgaccgacgca
gccctcgtgcgccttctgcaggccaaaccgcggcgcaccgcctcgggcgtggccaccatc
accgtgctcacgaagccctggccgtgctcgggcgcctgcgtgttctgtccgaacgatatc
cgtatgccgaagagctatctttccgacgagccggcctgccagcgggccgagcgatgctgg
ttcgaccccttcctccaagtggccgcgcgcctgcggacgctgaccgccatggggcatgtc
accgacaaagtggagctcatcgtgctgggcggcacctggagcgactaccccgaaagctat
cagcgctggttcataggcgagctcttccgcgctttgaacctgcccgatgaggaacgcgcc
cgtgaagcgaccgagcgccagaggtggtacgagagccgcggccttccccgcgatcgcgat
gccctggccgctgcggcagcatccctccaacagcgcatcgatgccggagagctcacctac
aacgaggcatggcgggaggcctatgcggcagagggcccacgcgggcacgaggccgaggca
ttcccgcatcccggcatttcgacggcggcccagagggcagaccaaggtctgcccctacgg
gaagacgctgaaagcgcagcaccgaaggaactttcctgggacgatcttttcgccctgcat
cgcgccaacgaaacggcaccgaagcgcgtcgtcgggctggtggcggaaacgcgccccgac
ctcgtcaccgccgatgcctgccgcagcctgcgcgcactcggctgcaccaaggtgcagatc
ggcatccagagcctctccgacgaccttctcgccgccaacggccgcgccatcacgtccgcg
cgcatcgccgatgccatggccctcttgcggcggttcggcttcaaaagccacgtgcacttc
atggtgaacctgctcggcgccgaccccgcctccgacattgccgactaccgtcgtctcgtc
accgacccggcgtttctgcccgatgaggtgaagctctatccctgctgccttgtggaaagc
gcccaactcactgactgctacgaggccggccgctggcgcccctacaccgaggaagagctc
gtgagagtcctcgtccaggacgtgctggccaccccgccctggacgcgcatctcccgcatg
gtccgcgacatctccgccaccgacatcctcgccggcaacaagaagaccaacctgcgccaa
gtggtagaagccgccgttgatgccacagacgaagcggttgccgagattcgctcccgcgaa
atctccgtagaaggcgccaccgtgggcgacctttcccttcagaccatcgcctaccagacc
gccaccaccgaagagcgcttccttgaatggatcacccccgaaaacaagatcgccggcttc
tgccgcctgtcgctgccgacggcacttccccgcgacaccgccaacgagtcctctccccct
cccatcaagagcgagcaaagcgaggcgaggggttcctcgcttgcttccccctccgcaccg
caggaggccatgatccgcgaagtgcatgtgtacgggaaggtggccgccctgcaccgcacc
ggcgagggcacccagcatctgggcctcgggcgggcgctcgtggaagaggcctgcgcccaa
gcgacggcagccgggtacaccgcgattaacgtcatcagcgccgtgggcacccgcgtctac
taccgcaacctcggctttaaggacgccgggctctaccagaagcggccgctgccatga

DBGET integrated database retrieval system