KEGG   Adlercreutzia equolifaciens: AEQU_2085Help
Entry
AEQU_2085         CDS       T02875                                 

Definition
putative glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
aeq  Adlercreutzia equolifaciens
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aeq00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AEQU_2085
   00330 Arginine and proline metabolism
    AEQU_2085
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    AEQU_2085
Enzymes [BR:aeq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     AEQU_2085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2620979..2621947
Genome map
AA seq 322 aa AA seqDB search
MITRLTFDQISTAVHDAYEACKDIKGGQNAHYIPYLANVNSDLFGISLCLPDGRLISVGD
TDYRFGIESVSKVHTAILALEQHGAQAILDDIGADATGLPFNSIFAILLENDRPSTPLVN
AGAIAACSLVKPHGDADGKWKAIFDNMTALLGSKPQLIDELYHSESATNFDNRSITWLLQ
EYGRMYDDPEMSLDLYTRQCSLGVTAEQLAISAATIADDGVNPLTKKRVFGAALTSKVVA
LMSAVGFYEHSGDWLYATGLPAKTGVGGAVIGVMPGLFGVCAFAPPLDDAGNSVKAQAAL
KHLMKSLNLNVFSNTHFDLVEA
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgatcacccgtctcaccttcgaccagatcagcaccgccgtgcacgacgcctacgaagcc
tgcaaggacatcaagggcggccaaaatgcgcactacattccctatctcgccaacgtgaat
tccgacctgttcggcatcagtctgtgcctgccggacggccggctcatctctgtgggcgac
accgactaccgcttcggcattgaatcggtctcgaaagtgcacacggctattctggcactg
gaacagcacggcgcgcaggcgatcctcgacgacatcggcgccgatgccacggggctgccg
ttcaactccatcttcgccatcttgctggaaaacgaccgaccctccacgccgctcgtgaac
gccggcgccatcgcggcctgttcgctcgtcaagccccacggcgatgccgatgggaaatgg
aaggccatcttcgacaacatgaccgctcttttgggaagcaagccccaactcatcgacgag
ctgtaccattccgaatccgccacgaacttcgacaaccgctccatcacgtggctgctgcaa
gagtacggccgcatgtacgatgatccggagatgtcgctcgacctgtacacgcgccagtgc
tcactgggcgtgacggccgagcagctggccatctcggcggccaccatcgccgacgacggc
gtgaaccccctcacgaagaagcgcgtgttcggcgcagcgctcacttccaaggtagtcgcg
cttatgagcgccgtcggcttctacgagcactcgggcgactggctgtacgccacggggctg
cccgcgaaaaccggcgtgggcggtgccgtcatcggcgtcatgcccggcctgttcggcgtg
tgcgccttcgcgccgccgctggatgacgcgggcaattccgtgaaggcccaggcggcgctc
aagcacctgatgaagagcctgaatctgaacgtcttctccaacacccatttcgatctcgtc
gaggcctag

DBGET integrated database retrieval system