KEGG   Asticcacaulis excentricus: Astex_0209Help
Entry
Astex_0209        CDS       T01378                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
aex  Asticcacaulis excentricus
Pathway
aex00020  Citrate cycle (TCA cycle)
aex00190  Oxidative phosphorylation
aex00650  Butanoate metabolism
aex01100  Metabolic pathways
aex01110  Biosynthesis of secondary metabolites
aex01120  Microbial metabolism in diverse environments
aex01130  Biosynthesis of antibiotics
aex01200  Carbon metabolism
Module
aex_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aex_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
aex_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:aex00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Astex_0209
   00650 Butanoate metabolism
    Astex_0209
  Energy metabolism
   00190 Oxidative phosphorylation
    Astex_0209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ADU11909
JGI: Astex_0209
UniProt: E8RNZ6
Position
1:227753..228127
Genome map
AA seq 124 aa AA seqDB search
MVDSYLKQRSAKDWKKSEKHGAGEWLAERWTSVALFFLTLWAAWSAFGLANQGYEAALSF
VKVPLNAGLLAATFVITMWHTYMGLNANVLDYFPNSRALRLLNLLFCLAVLAVALGGIYL
AFKA
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggttgactcctatctgaaacaacgctcggcgaaggactggaaaaagtccgaaaagcac
ggggctggtgagtggctggccgaacgctggacctcagtcgccctgtttttcctgaccctt
tgggccgcctggagcgctttcggtctggccaatcagggctatgaagccgcgctgtctttc
gtaaaggtgccgcttaatgccgggcttctggctgcgaccttcgtgatcaccatgtggcat
acctatatgggcctgaacgccaatgttctggactacttcccgaactcacgcgcgctgcgc
cttctcaacctcctcttttgtctggccgttctcgctgtggcgctgggcggcatctatctg
gctttcaaggcgtaa

DBGET integrated database retrieval system