KEGG   Asticcacaulis excentricus: Astex_0238Help
Entry
Astex_0238        CDS       T01378                                 

Definition
2-oxoglutarate dehydrogenase, e2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
aex  Asticcacaulis excentricus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:aex01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:aex00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:aex00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:256439..257977
Genome map
AA seq 512 aa AA seqDB search
MADILTPVLGESVSEATIAKWTKKPGDAVKKDEILVELETDKVSLEVAAPADGTLTEILA
GEGDTVTPGAVLGRIGAAGAAVASAPAAAPAATPAPAATPAAAPAAAGGALLDVKTPVMG
ESVAEGAISRWAKKVGEVVKKDEILVEIETDKVAVEVASPADGVIAEIVAADGATVTPGQ
VIARIAAGASAGSVAAAPAAAPAPVAAPASAPQKASEHLSPAVQRIVSETGLSTAGIAGT
GKDGRITKGDALAALSTPSAVAVAPVAAAPSAPVAPREVGPREERVKMTRLRQTIARRLK
ESQNTAAQLTTFNEVDMSTVMSLRNAYKDVFEKRHGVKLGFMSFFAKAVVAALKDIPALN
AEIEGTDIIYKNHYDLGVAVGTEKGLVVPVLRNVDDLSLAGIEKGIAALGKQARDGTLSL
DQLQGGTFTITNGGIYGSLMSTPILNMPQVGILGMHAIKERPMVVNGQIVARPMMYLALS
YDHRIVDGKEAVTFLVRVKEGLEDPQRFVLDV
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggccgacatccttacccccgtcctcggcgagtccgtttccgaggccaccattgccaag
tggaccaagaagcccggcgacgccgtgaagaaggacgaaatcctcgtcgagttggaaacc
gataaggtctcgctcgaagtggccgcccccgctgacggcaccctgaccgaaatactcgcc
ggtgaaggcgataccgtcacccccggtgccgtgctgggccgtatcggcgctgccggtgct
gcggtcgcttccgccccggcggctgcgcctgccgcgaccccggcgcccgcagctactccg
gctgccgctccggctgcggcgggtggtgccctgctcgacgtcaagaccccggtgatgggc
gagtcggtggccgaaggcgccatctcgcgctgggccaaaaaggtcggcgaagtggtgaag
aaggacgaaattctcgtcgaaatcgaaaccgataaggttgctgtcgaagtggcctcgccg
gccgatggcgtgatcgccgaaatcgtcgccgcagacggcgcgactgtcacgccgggtcag
gtcattgcccgtatcgccgccggcgcttcggcgggttcggtggccgctgcccccgccgcc
gctccggctccggtggctgctcccgcttcggccccgcaaaaggcctctgagcacctgtcg
cctgccgttcagcgtatcgtttccgaaaccggcctgagcactgccggtatcgccggcacc
ggcaaagacggccgcatcaccaagggcgacgccctcgccgccttgtccacgccctcggcg
gtcgctgtcgccccggtggccgctgcgccttcggctccggtcgccccgcgcgaagtcggc
ccgcgtgaagagcgcgtgaagatgacccgcctgcgtcagaccattgcccgccgcctgaag
gagtcgcaaaacaccgcggctcagctcaccaccttcaacgaagtggacatgtccaccgtg
atgagcctgcgcaacgcctataaggacgtctttgaaaagcgtcacggtgtgaagctgggc
tttatgtccttcttcgccaaggccgtcgtcgccgccctgaaggacattccggcgctcaac
gccgaaatcgaaggcacggacatcatctataagaaccactacgacctcggcgtcgccgtg
ggcacggaaaagggtctggtcgtgccggtcttgcgtaatgtcgatgacctgtcgctggcg
ggtatcgaaaagggcatcgccgcgctgggcaagcaggcacgtgacggcaccctgtcgctg
gatcagcttcaaggcggcaccttcaccatcaccaatggcggcatctatggctcgctgatg
tctacgcctatcctcaacatgccgcaggtcggtattcttggaatgcacgccatcaaggaa
cgcccgatggtcgtcaacggtcagatcgtcgcccgtccgatgatgtacctggccctgtct
tacgatcaccgcatcgtggacggcaaggaagccgtgaccttcctcgtccgcgtcaaggaa
ggtttggaagacccgcaacgtttcgtcctcgatgtgtaa

DBGET integrated database retrieval system