KEGG   Asticcacaulis excentricus: Astex_0376Help
Entry
Astex_0376        CDS       T01378                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
aex  Asticcacaulis excentricus
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:aex00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Astex_0376
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Astex_0376
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Astex_0376
Enzymes [BR:aex01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Astex_0376
Exosome [BR:aex04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Astex_0376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(393341..394804)
Genome map
AA seq 487 aa AA seqDB search
MSVRVFSLLFVALSLPLSAVAQTAPAILPATRDLTQDAGFKAQQAAIKAAAAQTPNTGRA
KNVILFIGDGMGINSVTAGRILAGQLRGQDGASYVLSFEALPYTAFSKTFSANNLVTDSA
NGISAITTGVKTINGAIGVHRDVNSKSCDGVAAARVLTIAEQAKLSGRSAGAVTTSGITD
ATPAGTYGHTSTRSWRSDADLPPEAVAAGCTDLARQLVQAPAALRLDVAMGGDLEDFLPV
TAGGVRKDGRDLTAEWKSQKNAAVLTGKAQLETLNTKTSGPVLGLFSKGDLPSPLDNPQD
VPGLDEMTAKAIDLLSRNEKGYFLLVESASIDKWHHKNNAHRALHDVDELAKAVSVALAK
TDPRNTLILITADHSHGLTLSGYAPRNSRIDGVSGQGDEAYPLLSYATGPGGEHPQTGSY
KPEETEALGFTNPALFGMSSAAHGGEDVPVYARGPQAYLVRSTVDSTYLYQVMARALFGA
ETPKTKP
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtccgcgtcttcagcctgcttttcgtcgcgctcagcctgccgctttctgcagtc
gcgcaaaccgcacccgcaatcctccccgccacgcgcgacctgacgcaggacgccggtttt
aaagcgcagcaagcagccatcaaggccgccgctgcccagacccccaatacgggtcgtgcg
aagaacgtcatcctgtttatcggcgacggcatgggcatcaattcggtcaccgccgggcgc
atactggccgggcagctacgtggtcaggacggagccagctacgtactgtcgttcgaagcc
ctgccctatacggccttttccaagaccttctcggccaataatctggtcaccgattccgcc
aacggtatctcggctatcaccaccggcgttaagacgatcaacggcgctatcggcgtgcat
cgcgatgtgaacagcaagagctgcgacggtgtcgcggccgcccgtgtgctgaccatcgcc
gaacaggctaagctatcgggccgctcagccggcgccgtcaccacctccggcatcacagac
gcgaccccggcgggcacctatggccacacctcgacgcgcagctggcgctcggacgccgac
ctgccgcccgaagctgtggccgcagggtgcaccgatctggcccggcaattggtacaggct
ccggcggcgctgcgccttgacgtcgccatgggtggcgatctcgaagatttcctgcccgtg
accgccggtggcgtgcgcaaagatgggcgcgacctgaccgccgagtggaagtcgcaaaaa
aacgccgccgtcctgacaggtaaggcgcagctggaaaccctcaatacaaaaacatcaggt
ccagtgctcggtctgtttagcaagggcgacctgccctcgcccctcgacaatccgcaagac
gtgccgggtctcgatgagatgaccgcaaaggcgatcgacctcctgtcacgaaatgaaaag
ggctacttcctgctggtcgaatccgcctcgattgacaagtggcaccataagaataatgcc
caccgcgccctgcacgatgtcgatgagctggccaaggcggtgagcgttgccctggccaag
accgaccctaggaacacgctgatcctgattaccgctgaccacagccacggcctgaccctg
tccggttacgcgccgcgcaacagccgtatcgacggcgtgtcaggtcagggtgatgaagcc
tatccgctgctcagctacgccaccggccccggcggagaacacccgcaaacgggcagctat
aagccggaggaaaccgaggcgctgggcttcaccaatccggcccttttcggcatgtcgagc
gcggctcatggcggcgaggacgtgccggtctatgcgcgtggccctcaggcctatctggtg
cgctcgaccgtggactcaacctatctctaccaggtcatggcccgcgctctgttcggggcg
gagacgcctaagacaaagccgtag

DBGET integrated database retrieval system