KEGG   Asticcacaulis excentricus: Astex_0602Help
Entry
Astex_0602        CDS       T01378                                 

Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
aex  Asticcacaulis excentricus
Brite
Enzymes [BR:aex01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Astex_0602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(639002..640018)
Genome map
AA seq 338 aa AA seqDB search
MGAALLSACGRGEAATGAIAPLKSHVPFPLGVCAMTAQMGDPQWAAMIATHFDRITPEWE
MKMEYILQPDGSLRFDAPDRIVQQARNYGQSVLGHTLIWYAQDGDYFQKLKSQRQAFEAA
YRAYIRDVMAHYIGYVDGWDVVNEPILDDGSDLRDCLWREVLGDDYIDIAYQAAHEADPA
CPLILNDYNLEYYPAKRKRFLALVEGMLKRGVPLQVLGTQTHIAADLPRGAIRETLRDLA
ATGLKIHLSELDISLKEAAKNALDFRNYRDAQRALYEEAAEAYAALPTAQQFGLTVWGLR
DKDSWYNRKDKGLIADEPLLFDDAGQLKPVGQAFVKAL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgggcgccgccctgctcagcgcctgcgggcgcggcgaagcggccaccggtgccatcgcg
cctctgaaatcgcacgtgccgtttccgctcggcgtctgcgcgatgaccgcgcagatgggc
gacccgcaatgggccgccatgatcgccacccatttcgaccgcatcacgccggaatgggag
atgaagatggaatacatcctccagcccgacggcagcctgcgctttgatgcgcccgaccgc
atcgtgcagcaggcccgaaactatggtcagtccgttctggggcacaccctgatctggtac
gcgcaggacggcgactatttccagaagctgaaaagccaacgccaggcgttcgaggccgcc
tatcgcgcctatatccgcgacgtgatggcccactacatcggctatgtcgatggctgggac
gtggtcaatgaaccaatcctcgacgacggttcggacctgcgcgactgcctgtggcgcgag
gttttgggcgacgactacatcgatatcgcctatcaggccgcgcatgaagccgaccccgcc
tgcccgctgatcctcaacgactacaatctcgaatactatccggccaagcgcaaacgcttc
ctcgctctggtcgaggggatgctgaaacgcggcgtgcccctgcaggttctgggcacgcaa
acccatatcgccgctgatctgcccagaggcgcaatccgcgaaaccctgcgtgatctggcg
gcaacgggcctgaaaatccatctgtcagagctcgacatcagcctgaaagaagcggcgaaa
aacgcgctcgattttcgcaattaccgcgacgcccagcgcgccctttatgaagaggccgcc
gaagcctatgcggccctgcccactgctcaacagttcggcttgaccgtttggggcctgcgc
gacaaggactcgtggtataatcgcaaggacaaagggctgatcgccgacgagccactcttg
ttcgatgatgcggggcagttgaaacccgtcggtcaggccttcgttaaggcgctgtag

DBGET integrated database retrieval system