KEGG   Asticcacaulis excentricus: Astex_0613Help
Entry
Astex_0613        CDS       T01378                                 

Definition
(GenBank) response regulator receiver modulated CheB methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
aex  Asticcacaulis excentricus
Pathway
aex02020  Two-component system
aex02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:aex00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Astex_0613
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Astex_0613
Enzymes [BR:aex01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Astex_0613
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     Astex_0613
Two-component system [BR:aex02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Astex_0613
Bacterial motility proteins [BR:aex02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Astex_0613
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg
Motif
Other DBs
NCBI-ProteinID: ADU12300
JGI: Astex_0613
UniProt: E8RRA9
Position
1:complement(649497..650723)
Genome map
AA seq 408 aa AA seqDB search
MSLNPNPSVSLRPLRVMIVDDSAVVRGLVTRWIEAESDMVLVGSATDGQKGIDKLKELQP
DVLILDIEMPNMNGLEALPKMLAAKPGLKILMASTLTTRGASVTIRALELGAADYVPKPD
SARIGGADGFKSELLTKVRALCGRTRAWPNAAAAGASTTGPSAPVNLNTPTPGIVAPIRR
IDRPVGTPAPAPAPATPNGHVAAAPRVRTMTGPRRCDILLVGASTGGPPALRNFLAGLGP
DWRIPVLIVQHMPSTFTTILAEHLDKALPQTVVEAQDGMSLKGSHIYIAPGDFHMTLKGT
PGQPSLRLDQSPPVNWCRPAVDPLFKSGAELYGKNVVAVVLTGMGHDGRDGARALVDVNA
TVMVQDEKSSVVWGMPGAVAEAGLAEFIKPIDGLAQTCRAIAKGERII
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcttaaccccaatccctcggtatcgctgcgccctctgcgggtgatgatcgttgat
gactcggcggtcgtgcgcggccttgttacccgctggatcgaagcggaaagcgacatggtt
ctcgtcggctccgccacggacggtcagaaaggcatcgacaaactcaaggagcttcagccc
gatgtgctgatccttgatatcgagatgccgaacatgaatggcctcgaagccctgcccaag
atgctggcggccaagccgggcctgaagatcctgatggcgtcgaccctgacgacgcgaggg
gcctcggtcaccatccgcgcccttgaactgggcgcggccgactatgtgcccaagcccgac
tccgcccgtatcggcggggcagacggcttcaaaagcgagctactgaccaaggtacgcgcc
ctgtgtggtcgcacgcgcgcctggccaaatgccgcggctgccggtgcgtcaactacgggc
ccaagcgccccggttaaccttaatacccccacccccggtatcgtcgcaccgatccgccgc
atcgaccgtccggtaggaactccggcacccgctccggcaccggcaacgccgaacggccac
gtcgccgccgcaccgcgcgtgcgcaccatgaccggcccgcgccgttgcgacatccttctg
gtcggcgcctctacgggcggccccccggcgctgcgcaacttcctcgcaggtcttggtccg
gactggcgcatcccagtgctgatcgttcagcacatgccctcgacctttaccacaattctc
gccgaacacctcgacaaagccctcccacagaccgtggtcgaagcgcaggacggtatgagc
ctgaagggcagccatatctatattgcgccgggcgatttccacatgacgctgaaaggcaca
cctggtcagccttcgcttcgcctcgatcagtcgccccccgtcaactggtgccgtccggcg
gtcgatccgctgtttaaatcaggcgcagaactgtacggcaagaacgtcgttgccgtcgtt
ctgaccggcatgggccacgatggccgtgacggcgcgcgggctctggttgatgtgaatgcc
accgtcatggtgcaagacgaaaagtcgtcggtcgtctgggggatgcccggtgccgtcgcc
gaagccggcctggccgaatttataaaacccatcgacggtctggcgcagacgtgccgggcc
atcgccaaaggtgagagaataatatga

DBGET integrated database retrieval system