KEGG   Asticcacaulis excentricus: Astex_0693Help
Entry
Astex_0693        CDS       T01378                                 

Definition
cheb methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
aex  Asticcacaulis excentricus
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:aex02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:aex02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(737566..738135)
Genome map
AA seq 189 aa AA seqDB search
MSMLPRKAVVIGASAGGVEALSAVLPHLPADHCAVLVVIHLPSNRHSVLADLFSDKCRMK
VVEAEDKAPIDAGTIYFAPPDYHLMVEPDFTIALSNEAPVWFSRPSIDVLFETAADAYGP
GLTGVILTGANEDGAGGLRAVMAQGGRGLIQSPETAYARLMPETAQSLCPKALVRPLDQL
ADELLAEAA
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgctcccccgcaaggccgtggtcattggggcctcggccggaggcgtagaagcc
ctgtcggccgtcctgccgcacctgccggcggaccactgcgcggttttggtggtcatccac
ttgccgtcaaaccggcacagcgttctggccgatctgttcagcgacaaatgccgtatgaag
gtcgtggaagccgaagataaggcccctatcgatgccggcaccatctatttcgcccccccc
gattatcacctgatggttgaacccgactttaccattgcactctcgaacgaagcgccggtg
tggttttcgcgcccctctatcgacgtgctgtttgaaacggcggcggatgcttatgggccg
ggtctgaccggggtgatcctgaccggcgccaacgaggatggcgcaggtggcctgcgcgct
gttatggcgcagggagggcgcggcctgatccagtcgccggagacggcctatgcgcggcta
atgcctgaaaccgcccagtctctgtgcccgaaggcgctcgtacgccctctcgatcaactg
gctgacgaactgctggcagaggccgcctga

DBGET integrated database retrieval system