KEGG   Asticcacaulis excentricus: Astex_0791Help
Entry
Astex_0791        CDS       T01378                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
aex  Asticcacaulis excentricus
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:aex00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:aex00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:aex02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:838074..839780
Genome map
AA seq 568 aa AA seqDB search
MSATYKVSRRKALMAFGLMGAAPAVSGSGQAPIKGAHFAHGVAAGDPLSDRLILWTRVSG
LEVATEVVWQIAEHADFRKLTGTGRVITDAGCDYTVKIDAQGLKAGQIYYYRFVCQGVIS
PVGQAKTLPVQTDRVVLAVASCSLFSNGYFNAYRAIADLKEVDAVLHLGDYIYEYGAGLN
DYGMGNGRLLGRIPEPPHEIVTLADYRTRHAQYKADTDLQAAHARAAWICVFDDHEMCND
PWMHGAENHQPATEGDFDVRKAAALKAYREWMPIRDPQPGMLSEAIYRSFRFGQLAELFM
TETRFLGRTKQLDYQSDLKRDAAGKADYAAFRAELNAPERELLGATQRQWLQAGLKASVS
DGVRWQVFGNQVVMAKVKGPDLKALYGEERITGMLKMLPPNVAGVIGPMIDLFSQSEDPL
PLNLDAWDGYPAERERLYGLIREAKARVVVLSGDSHQAWANELHDAKGERVAVELGVTAI
SSPTVWFDHLLPNFSLAKVLADQNDEVLAASTDRNGFVRLTLTPETATGEWVSVSTITTR
DYLVTVDGTFAAEAEVDGVGPLKVISIV
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgacgtataaggtaagccgccgcaaggcactgatggccttcggtctgatgggg
gcggcgccggccgtctccgggtccggtcaggcgccgatcaagggcgcgcactttgcgcac
ggcgtggcggcgggcgatccgttgagcgaccgcctgatcctgtggacgcgcgtgtcgggc
cttgaggtcgctaccgaagtcgtgtggcagatcgccgaacacgctgatttccgcaagctg
accggcaccggtcgtgtcatcaccgacgccgggtgcgactacacggtcaagatcgatgcg
cagggtcttaaggcggggcagatctactattaccgcttcgtctgtcagggcgtgatctca
cccgttgggcaggccaagaccttgcctgttcagaccgatcgcgtcgtgctggccgtcgcc
tcgtgctcgctgttttccaacggttacttcaatgcttatcgcgccattgccgatctcaaa
gaggtcgatgccgtcctgcacctgggcgactatatctacgaatacggcgcgggactgaac
gactacggcatgggcaatggccgcctgctgggccgcatccccgagccgccgcacgagatc
gtcactctggccgactaccgcacccgtcacgcccagtacaaggccgataccgaccttcag
gcggcgcacgcccgcgcggcttggatatgcgtctttgacgaccacgaaatgtgtaacgac
ccgtggatgcacggcgccgaaaaccaccagccggcgaccgaaggcgacttcgatgtgcgt
aaggccgctgcgctgaaggcctatcgcgaatggatgcccattcgtgacccgcagccgggt
atgctgtccgaagccatctaccgctccttccgtttcgggcaactggccgagctgttcatg
acagagacgcgctttttgggccgtaccaagcagctcgactaccagagcgatctcaagcgc
gatgcggcaggcaaggccgattacgccgcctttcgcgccgagctgaacgcgcccgaacgc
gaactgttgggggccacgcagcgccagtggcttcaggctggcctgaaggcctcagtgtcc
gatggcgtgcgctggcaggtgttcggtaaccaggtggttatggccaaggtcaagggcccg
gacctcaaggcgctttatggtgaagagcgcatcactggcatgctgaagatgttaccgccc
aatgtggccggcgtcatcgggccgatgatcgacctgttcagccagagcgaagacccgctg
ccgctcaatctcgatgcctgggatggctatccggccgagcgcgaacgcctctatggcctc
atccgcgaagccaaggcgcgtgtcgtggtgctgtcgggcgacagccatcaggcctgggcc
aacgaactgcacgacgccaagggcgagcgtgtggcggtggagctgggcgtcacggcaatt
tcgagcccgaccgtgtggttcgaccacctgctgcccaatttcagccttgcgaaggtgctc
gccgatcagaacgatgaagtgctggccgcctcgaccgaccgcaacggctttgtgcgtttg
accctgactccagaaacagcgacaggtgagtgggtgtcggtttcgaccatcaccacgcgc
gattatctggtcacggtagatggcaccttcgccgccgaggctgaggtcgatggcgtcggg
cctttgaaggtgatttctatcgtctga

DBGET integrated database retrieval system