KEGG   Asticcacaulis excentricus: Astex_0885Help
Entry
Astex_0885        CDS       T01378                                 

Definition
recombination protein recr
Orthology
K06187  
recombination protein RecR
Organism
aex  Asticcacaulis excentricus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:aex03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:935984..936586
Genome map
AA seq 200 aa AA seqDB search
MASGAGPEIERLMALLSKLPGLGPRSARRAALALLKKREQLLIPLTAAMQDAAERVTSCH
ICGALSTRDPCATCADPTRDAAMICVVEEDSALWAMERVGAFSGRYHVLGGLLSALDGVR
PEDLRLSGLMQRVSSGGVEELVMALPATVEGQTTAHYIADRVKPLAPEVTITHLARGVPV
GGELDWLDDGTIAHAFKSRR
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcctctggtgccggacctgaaattgaacgtctgatggcgctgttgtccaagctcccg
ggtcttgggccccgctctgcgcgtcgggctgcgctcgctctgctcaaaaagcgcgagcag
ttgctgatcccgttgaccgcggccatgcaggatgctgctgagcgcgtcacctcgtgccac
atttgtggcgcgctttcgacccgtgacccgtgcgctacctgcgccgacccgacccgcgac
gccgccatgatctgcgtggtcgaagaagactccgccctgtgggctatggaacgcgtcggg
gccttttccggccgttatcacgtgctgggcggccttctgtcggcactggacggggtgcgg
cccgaagacctgcgcctgtcgggcttgatgcaacgcgtcagttcgggcggtgtcgaagaa
ctggtcatggccctcccggccacggtcgaaggccagaccacggcgcactatatcgccgac
cgggtcaagccgttggccccagaggtgaccatcacccatttggcgcggggcgtgccggtc
ggcggcgaactcgactggctcgatgacgggaccattgcccacgcatttaagagtagacgg
taa

DBGET integrated database retrieval system