KEGG   Asticcacaulis excentricus: Astex_0894Help
Entry
Astex_0894        CDS       T01378                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
aex  Asticcacaulis excentricus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:aex01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:aex00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(943833..944987)
Genome map
AA seq 384 aa AA seqDB search
MTNIPENTLDPVELTKALINHPSVTPVDAGAMDRVQQTLESLGFACERLKFREIENLYAR
RGTASPNLCFAGHTDVVPEGALDGWRSDPFAATIENGVLTGRGAVDMKGGIAAWIAAVSR
FDNVPGSLSFLITGDEEGEALDGTKKVVEHLRQTGEVIDHCIVGEPTSSAVLGDMIKVGR
RGSINATITVTGKQGHVAYPQRALNPIPVLVAVMAELDGRVLDEGYERFLPSNLEITTFD
VANKTTNLIPQTASGRINIRFNPTHSGASLQAWIEEVCARHAERSGAVIEVKAAISGEAF
LTEAGPFVDVIQNAILDVLKVEADPSTTGGTSDARFIRALCPVVEFGLVGQTMHQVNEAT
PVQDLYALTEAYTALISKYFKVFA
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatatacccgaaaacacgctcgatccggtcgaattgaccaaggccctgatcaac
catccgtctgtgactccggtggacgccggagcgatggaccgggtgcagcagacgctggaa
tcgctcggttttgcctgtgaacggctgaagttccgcgagattgaaaacctctatgcgagg
cgcgggacggcctcgcccaacctgtgctttgccggtcatacggacgtggtgcccgaaggc
gcgcttgatggctggcgctcggacccgtttgcggcaacgatcgaaaacggcgtgctgacc
gggcgcggagccgtcgatatgaagggcggcattgcggcgtggattgcggccgtgtcgcgc
tttgacaacgtgccggggtcgctgtccttcctgatcaccggcgacgaggaaggcgaagcg
ctggacggcaccaaaaaagtcgtcgaacacctgaggcaaacgggcgaggtcatcgaccat
tgcatcgtcggcgaacccacctcttcggcggtgctgggggacatgatcaaggtcggccgc
cgcggctcgatcaatgccacgatcacggtgacgggcaagcagggccacgtcgcctacccg
cagcgcgcgctcaatccgatcccggtgctggtggccgtcatggctgaactggacgggcgc
gtgctggatgagggctatgaacgcttcctgccgtccaatctcgaaatcaccacctttgat
gtggcgaacaagaccaccaacctgatcccgcaaacggccagcggacgcatcaatatccgc
tttaacccgacccattcgggcgcgtccttgcaggcgtggatcgaagaggtttgcgcccga
catgctgaacgtagcggtgcggtgatcgaggtgaaggccgccatttcgggcgaggccttc
ctcaccgaggccgggccgtttgtcgatgtcattcagaacgccatcctcgacgtgctgaag
gtcgaagccgatccgtcaaccacaggcggcacgtcggacgcgcgctttatccgcgccctg
tgcccggtggtggaattcggtctggtgggccagaccatgcaccaggtcaatgaagcgacc
ccggtgcaggacctctatgccctgaccgaagcctatacggcgctgatcagcaaatatttc
aaggtgttcgcttaa

DBGET integrated database retrieval system