KEGG   Asticcacaulis excentricus: Astex_0917Help
Entry
Astex_0917        CDS       T01378                                 

Definition
phosphoglycerate mutase 1 family (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
aex  Asticcacaulis excentricus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:aex00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Astex_0917
   01230 Biosynthesis of amino acids
    Astex_0917
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Astex_0917
  Energy metabolism
   00680 Methane metabolism
    Astex_0917
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Astex_0917
Enzymes [BR:aex01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Astex_0917
Exosome [BR:aex04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Astex_0917
  Exosomal proteins of melanoma cells
   Astex_0917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:971984..972700
Genome map
AA seq 238 aa AA seqDB search
MPKLILLRHGQSQWNLENRFTGWVDVNLTAEGEAQAVKGGELIKAEGIEIDRAFTSVLTR
AIRTCNLALDAAGQSYVPVIKDWHLNERHYGGLTGLDKAETAALHGDEQVKIWRRSYDVP
PPELSADSAYDFSKDRRYAGSVLPLTESLKTTLDRVLPFWDGSIVPALKSGDTVLVAAHG
NSIRAIIKLLFNLGEAEILEVEVPTSNPLVIDLDAALTPVSARYLDAERANPVPVLQG
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaactcattctcctccgtcacggccagagccagtggaacctagaaaaccgcttt
accggctgggtggacgtcaatctgacggccgagggcgaagcgcaggcggtcaagggcggt
gagctgatcaaggcggaggggattgagatcgaccgcgccttcacctcggtgctgacccgc
gccatccgtacctgcaatctggcgctggacgccgccgggcaatcctacgtgccggtgatc
aaggactggcacctcaatgagcgtcattatggagggctgacagggctggataaggccgaa
accgctgccctgcacggcgatgagcaggtaaagatctggcgccgttcctacgacgtgccg
ccgcccgaactgtcagccgatagcgcctatgacttctcgaaggatcggcgctacgccggt
tcggtcttgccgctgaccgagagcctgaagacgacgctggatcgcgtgctgcccttctgg
gacggctcaatcgtgccggcgctgaagtccggggatacggtgctggtggcggcgcacggt
aactcgatccgtgccattatcaagctcctgttcaacctcggtgaggccgagatactggag
gtcgaagtgccgacctcgaacccgctggtcatcgacctcgatgcggcgctgacgcccgtt
tcggccaggtatctcgatgctgagcgtgccaaccccgtgcccgttttacaagggtaa

DBGET integrated database retrieval system