KEGG   Asticcacaulis excentricus: Astex_0917Help
Entry
Astex_0917        CDS       T01378                                 

Definition
phosphoglycerate mutase 1 family (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
aex  Asticcacaulis excentricus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:aex01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:aex01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:aex00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:aex00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:aex00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:971984..972700
Genome map
AA seq 238 aa AA seqDB search
MPKLILLRHGQSQWNLENRFTGWVDVNLTAEGEAQAVKGGELIKAEGIEIDRAFTSVLTR
AIRTCNLALDAAGQSYVPVIKDWHLNERHYGGLTGLDKAETAALHGDEQVKIWRRSYDVP
PPELSADSAYDFSKDRRYAGSVLPLTESLKTTLDRVLPFWDGSIVPALKSGDTVLVAAHG
NSIRAIIKLLFNLGEAEILEVEVPTSNPLVIDLDAALTPVSARYLDAERANPVPVLQG
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaactcattctcctccgtcacggccagagccagtggaacctagaaaaccgcttt
accggctgggtggacgtcaatctgacggccgagggcgaagcgcaggcggtcaagggcggt
gagctgatcaaggcggaggggattgagatcgaccgcgccttcacctcggtgctgacccgc
gccatccgtacctgcaatctggcgctggacgccgccgggcaatcctacgtgccggtgatc
aaggactggcacctcaatgagcgtcattatggagggctgacagggctggataaggccgaa
accgctgccctgcacggcgatgagcaggtaaagatctggcgccgttcctacgacgtgccg
ccgcccgaactgtcagccgatagcgcctatgacttctcgaaggatcggcgctacgccggt
tcggtcttgccgctgaccgagagcctgaagacgacgctggatcgcgtgctgcccttctgg
gacggctcaatcgtgccggcgctgaagtccggggatacggtgctggtggcggcgcacggt
aactcgatccgtgccattatcaagctcctgttcaacctcggtgaggccgagatactggag
gtcgaagtgccgacctcgaacccgctggtcatcgacctcgatgcggcgctgacgcccgtt
tcggccaggtatctcgatgctgagcgtgccaaccccgtgcccgttttacaagggtaa

DBGET integrated database retrieval system