KEGG   Asticcacaulis excentricus: Astex_0917Help
Entry
Astex_0917        CDS       T01378                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
aex  Asticcacaulis excentricus
Pathway
aex00010  Glycolysis / Gluconeogenesis
aex00260  Glycine, serine and threonine metabolism
aex00680  Methane metabolism
aex01100  Metabolic pathways
aex01110  Biosynthesis of secondary metabolites
aex01120  Microbial metabolism in diverse environments
aex01130  Biosynthesis of antibiotics
aex01200  Carbon metabolism
aex01230  Biosynthesis of amino acids
Module
aex_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:aex00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Astex_0917
  Energy metabolism
   00680 Methane metabolism
    Astex_0917
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Astex_0917
Enzymes [BR:aex01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Astex_0917
Membrane trafficking [BR:aex04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Astex_0917
Exosome [BR:aex04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Astex_0917
  Exosomal proteins of melanoma cells
   Astex_0917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADU12598
JGI: Astex_0917
UniProt: E8RLA8
Position
1:971984..972700
Genome map
AA seq 238 aa AA seqDB search
MPKLILLRHGQSQWNLENRFTGWVDVNLTAEGEAQAVKGGELIKAEGIEIDRAFTSVLTR
AIRTCNLALDAAGQSYVPVIKDWHLNERHYGGLTGLDKAETAALHGDEQVKIWRRSYDVP
PPELSADSAYDFSKDRRYAGSVLPLTESLKTTLDRVLPFWDGSIVPALKSGDTVLVAAHG
NSIRAIIKLLFNLGEAEILEVEVPTSNPLVIDLDAALTPVSARYLDAERANPVPVLQG
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaactcattctcctccgtcacggccagagccagtggaacctagaaaaccgcttt
accggctgggtggacgtcaatctgacggccgagggcgaagcgcaggcggtcaagggcggt
gagctgatcaaggcggaggggattgagatcgaccgcgccttcacctcggtgctgacccgc
gccatccgtacctgcaatctggcgctggacgccgccgggcaatcctacgtgccggtgatc
aaggactggcacctcaatgagcgtcattatggagggctgacagggctggataaggccgaa
accgctgccctgcacggcgatgagcaggtaaagatctggcgccgttcctacgacgtgccg
ccgcccgaactgtcagccgatagcgcctatgacttctcgaaggatcggcgctacgccggt
tcggtcttgccgctgaccgagagcctgaagacgacgctggatcgcgtgctgcccttctgg
gacggctcaatcgtgccggcgctgaagtccggggatacggtgctggtggcggcgcacggt
aactcgatccgtgccattatcaagctcctgttcaacctcggtgaggccgagatactggag
gtcgaagtgccgacctcgaacccgctggtcatcgacctcgatgcggcgctgacgcccgtt
tcggccaggtatctcgatgctgagcgtgccaaccccgtgcccgttttacaagggtaa

DBGET integrated database retrieval system